eF-site ID 4xvc-A PDB Code 4xvc Chain A click to enlarge Title Crystal structure of an esterase from the bacterial hormone-sensitive lipase (HSL) family Classification HYDROLASE Compound Esterase E40 Source (4XVC) Sequence A:  MAKSPELDRVIGMIRERAATPRKTTDDDRRLYETMLGSMP LDDDIQTERLGVNGVPAEWIYAPGARDDQVFLYLHGGGYV IGSMRTHRVMLSHIARAAGCRVLGLDYRLAPETPFPAPVE DTVAAYRWLLAHGYDPSRIALGGDSAGGGLVVAALVALRY IGEPLPAAGVCLSPWIDMEATGESFTTNATMDPSVNKERV MSIAALYLGGKNPQAPLASPLYADLQGLPPLLVQVGGIET LLDDARALTTRAKAAGVDADLEVWDDMPHVWQHFAPILPE GKQAIARIGEFLRKQIG Description Functional site 1) chain A residue 77 type sequence G description binding site for residue PMS A 301 source : AC1 2) chain A residue 78 type sequence G description binding site for residue PMS A 301 source : AC1 3) chain A residue 145 type sequence S description binding site for residue PMS A 301 source : AC1 4) chain A residue 146 type sequence A description binding site for residue PMS A 301 source : AC1 5) chain A residue 175 type sequence W description binding site for residue PMS A 301 source : AC1 6) chain A residue 203 type sequence I description binding site for residue PMS A 301 source : AC1 7) chain A residue 269 type sequence H description binding site for residue PMS A 301 source : AC1 8) chain A residue 71-87 type prosite sequence FLYLHGGGYVIGSMRTH description LIPASE_GDXG_HIS Lipolytic enzymes "G-D-X-G" family, putative histidine active site. FLyLHGGGYvigSmrTH source prosite : PS01173

Display surface Download Links