eF-site ID 4xuj-H PDB Code 4xuj Chain H click to enlarge Title Nucleosome core particle containing adducts from treatment with a thiomorpholine-substituted [(eta-6-p-cymene)Ru(3-hydroxy-2-pyridone)Cl] compound Classification DNA-BINDING PROTEIN/DNA Compound Histone H3.2 Source Xenopus laevis (African clawed frog) (4XUJ) Sequence H:  KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVF ERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHA VSEGTKAVTKYTSAK Description Functional site 1) chain H residue 87 type sequence T description binding site for residue SO4 G 201 source : AC4 2) chain H residue 88 type sequence S description binding site for residue SO4 G 201 source : AC4 3) chain H residue 46 type sequence H description binding site for residue SO4 H 201 source : AC5 4) chain H residue 47 type sequence P description binding site for residue SO4 H 201 source : AC5 5) chain H residue 48 type sequence D description binding site for residue SO4 H 201 source : AC5 6) chain H residue 49 type sequence T description binding site for residue SO4 H 201 source : AC5 7) chain H residue 102 type sequence E description binding site for residue 4A6 H 202 source : AC6 8) chain H residue 106 type sequence H description binding site for residue 4A6 H 202 source : AC6 9) chain H residue 79 type sequence H description binding site for residue 4A6 H 203 source : AC7 10) chain H residue 117 type MOD_RES sequence K description N6-(2-hydroxyisobutyryl)lysine; alternate => ECO:0000250|UniProtKB:P0C0S8 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links