eF-site ID 4xqn-ABCDEFGHIJKL PDB Code 4xqn Chain A, B, C, D, E, F, G, H, I, J, K, L click to enlarge Title Crystal structure of AgrA LytTR domain in complex with promoters Classification DNA/DNA BINDING PROTEIN Compound DNA (5'-D(*AP*CP*AP*GP*TP*TP*AP*AP*GP*AP*AP*T)-3') Source (AGRA_STAAC) Sequence A:  ETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQI EFYGNLKELSQLDDRFFRCHNSFVVNRHNIESIDSKERIV YFKNKEHCYASVRNVKK B:  ACAGTTAAGAAT C:  AATTCTTAACTGT D:  ETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQI EFYGNLKELSQLDDRFFRCHNSFVVNRHNIESIDSKERIV YFKNKEHCYASVRNVKKI E:  ACAGTTAAGAAT F:  AATTCTTAACTGT G:  ETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQI EFYGNLKELSQLDDRFFRCHNSFVVNRHNIESIDSKERIV YFKNKEHCYASVRNVKKI H:  ACAGTTAAGAAT I:  ATTCTTAACTGT J:  ETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQI EFYGNLKELSQLDDRFFRCHNSFVVNRHNIESIDSKERIV YFKNKEHCYASVRNVKKI K:  CAGTTAAGAAT L:  ATTCTTAACTGT Description Functional site 1) chain C residue 10 type sequence C description binding site for residue EDO C 101 source : AC1 2) chain J residue 141 type sequence E description binding site for residue EDO C 101 source : AC1 3) chain I residue 11 type sequence T description binding site for residue EDO I 102 source : AC2 4) chain K residue 8 type sequence G description binding site for residue EDO L 101 source : AC3 5) chain L residue 11 type sequence T description binding site for residue EDO L 101 source : AC3 6) chain L residue 3 type sequence T description binding site for residue EDO D 301 source : AC4 7) chain G residue 194 type sequence D description binding site for residue EDO G 301 source : AC5 8) chain C residue 8 type sequence A description binding site for residue EDO J 301 source : AC6 9) chain C residue 9 type sequence A description binding site for residue EDO J 301 source : AC6 10) chain J residue 191 type sequence Q description binding site for residue EDO J 301 source : AC6

Display surface Download Links