eF-site ID 4xq4-A PDB Code 4xq4 Chain A click to enlarge Title X-ray structure analysis of xylanase - N44D Classification HYDROLASE Compound Endo-1,4-beta-xylanase 2 Source (XYN2_HYPJE) Sequence A:  IQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNS GDFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRN PLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQR VNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQ GLTLGTMDYQIVAVEGYFSSGSASITVS Description Functional site 1) chain A residue 82 type sequence N description binding site for residue IOD A 201 source : AC1 2) chain A residue 146 type sequence S description binding site for residue IOD A 201 source : AC1 3) chain A residue 65 type sequence S description binding site for residue IOD A 202 source : AC2 4) chain A residue 184 type sequence S description binding site for residue IOD A 202 source : AC2 5) chain A residue 83-93 type prosite sequence PLIEYYIVENF description GH11_1 Glycosyl hydrolases family 11 (GH11) active site signature 1. PLiEYYIVEnF source prosite : PS00776 6) chain A residue 87 type ACT_SITE sequence Y description Nucleophile => ECO:0000269|PubMed:26392527, ECO:0000305|PubMed:24419374 source Swiss-Prot : SWS_FT_FI1 7) chain A residue 178 type ACT_SITE sequence G description Proton donor => ECO:0000269|PubMed:26392527, ECO:0000305|PubMed:24419374 source Swiss-Prot : SWS_FT_FI2 8) chain A residue 74 type BINDING sequence L description BINDING => ECO:0000269|PubMed:24419374 source Swiss-Prot : SWS_FT_FI3 9) chain A residue 78 type BINDING sequence G description BINDING => ECO:0000269|PubMed:24419374 source Swiss-Prot : SWS_FT_FI3 10) chain A residue 89 type BINDING sequence I description BINDING => ECO:0000269|PubMed:24419374 source Swiss-Prot : SWS_FT_FI3 11) chain A residue 123 type BINDING sequence V description BINDING => ECO:0000269|PubMed:24419374 source Swiss-Prot : SWS_FT_FI3 12) chain A residue 127 type BINDING sequence S description BINDING => ECO:0000269|PubMed:24419374 source Swiss-Prot : SWS_FT_FI3 13) chain A residue 137 type BINDING sequence Y description BINDING => ECO:0000269|PubMed:24419374 source Swiss-Prot : SWS_FT_FI3 14) chain A residue 172 type BINDING sequence Q description BINDING => ECO:0000269|PubMed:24419374 source Swiss-Prot : SWS_FT_FI3 15) chain A residue 39 type CARBOHYD sequence W description N-linked (GlcNAc...) asparagine => ECO:0000255 source Swiss-Prot : SWS_FT_FI5 16) chain A residue 62 type CARBOHYD sequence F description N-linked (GlcNAc...) asparagine => ECO:0000255 source Swiss-Prot : SWS_FT_FI5 17) chain A residue 174-185 type prosite sequence VAVEGYFSSGSA description GH11_2 Glycosyl hydrolases family 11 (GH11) active site signature 2. VavEGYFSSGsA source prosite : PS00777

Display surface Download Links