eF-site ID 4xko-A PDB Code 4xko Chain A click to enlarge Title N-terminal domain of Hsp90 from Dictyostelium discoideum in hexagonal form with PEG Classification CHAPERONE Compound Heat shock cognate 90 kDa protein Source Dictyostelium discoideum (Slime mold) (HSC90_DICDI) Sequence A:  QVERFTFQAEINQLMSLIINTFYSNKEVFLRELISNASDA LDKIRYQSLTDASVLESKTELEIKIIPDKTAKTLTLIDSG IGMTKTDMVKNLGTIARSGTKNFMEQLQSGAADISMIGQF GVGFYSAYLVADTVIVHSKNNDDEQYVWESSAGGEFTIAL DHTEPLGRGTKIVLHMKEDQLDYLDETKIKNLVKKHSEFI QYPISLLTIKEKEVD Description Functional site 1) chain A residue 40 type sequence N description binding site for residue PEG A 301 source : AC1 2) chain A residue 95 type sequence N description binding site for residue PEG A 301 source : AC1 3) chain A residue 96 type sequence L description binding site for residue PEG A 301 source : AC1 4) chain A residue 176 type sequence I description binding site for residue PEG A 301 source : AC1 5) chain A residue 73 type sequence K description binding site for residue TAM A 302 source : AC2 6) chain A residue 189 type sequence D description binding site for residue TAM A 302 source : AC2 7) chain A residue 190 type sequence E description binding site for residue TAM A 302 source : AC2 8) chain A residue 191 type sequence T description binding site for residue TAM A 302 source : AC2 9) chain A residue 192 type sequence K description binding site for residue TAM A 302 source : AC2 10) chain A residue 27-36 type prosite sequence YSNKEVFLRE description HSP90 Heat shock hsp90 proteins family signature. YsNKEVFLRE source prosite : PS00298 11) chain A residue 40 type BINDING sequence N description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 12) chain A residue 82 type BINDING sequence D description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 13) chain A residue 95 type BINDING sequence N description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 14) chain A residue 128 type BINDING sequence F description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links