eF-site ID 4xaa-A PDB Code 4xaa Chain A click to enlarge Title Crystal Structure of AviO1 from Streptomyces viridochromogenes Tue57 Classification OXIDOREDUCTASE Compound Putative oxygenase Source Streptomyces viridochromogenes Tue57 (Q93KW4_STRVR) Sequence A:  TATLDRAAAIERFRRDGFANAGPVLAPDAIARLKAGAERL ITRFTDEGLRSDDYWNFPVEGDERPVLYRVHNLEKQDWAP ERDLLHREELAQLAAAFVDGPVVPTAYALVLKEPYRAAEV PWHRDRVNVGPRTVCNLSICLDDAGPHNGCLEAVPGSHLL PDDAEVAKVRATGPVVPVPVSQGDVVVHDVRLVHGSGPNA NGSWRRTIVIEYADPAAPPAP Description Functional site 1) chain A residue 125 type sequence H description binding site for residue NI A 301 source : AC1 2) chain A residue 127 type sequence D description binding site for residue NI A 301 source : AC1 3) chain A residue 196 type sequence H description binding site for residue NI A 301 source : AC1

Display surface Download Links