eF-site ID 4x3g-A PDB Code 4x3g Chain A click to enlarge Title Crystal structure of SIAH1 SINA domain in complex with a USP19 peptide Classification LIGASE Compound E3 ubiquitin-protein ligase SIAH1 Source Homo sapiens (Human) (UBP19_HUMAN) Sequence A:  ANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPC PASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDIN LPGAVDWVMMQSCFGFHFMLVLEKQEKYQQFFAIVQLIGT RKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNS DCLVFDTSIAQLFAENGNLGINVTISMC Description Functional site 1) chain A residue 128 type sequence C description binding site for residue ZN A 601 source : AC1 2) chain A residue 135 type sequence C description binding site for residue ZN A 601 source : AC1 3) chain A residue 147 type sequence H description binding site for residue ZN A 601 source : AC1 4) chain A residue 152 type sequence H description binding site for residue ZN A 601 source : AC1 5) chain A residue 98 type sequence C description binding site for residue ZN A 602 source : AC2 6) chain A residue 105 type sequence C description binding site for residue ZN A 602 source : AC2 7) chain A residue 117 type sequence H description binding site for residue ZN A 602 source : AC2 8) chain A residue 121 type sequence C description binding site for residue ZN A 602 source : AC2 9) chain A residue 93-153 type ZN_FING sequence SVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPA SCKWQGSLDAVMPHLMHQHK description SIAH-type => ECO:0000255|PROSITE-ProRule:PRU00455 source Swiss-Prot : SWS_FT_FI1 10) chain A residue 98 type BINDING sequence C description BINDING => ECO:0000269|PubMed:28546513, ECO:0007744|PDB:5WZZ source Swiss-Prot : SWS_FT_FI2 11) chain A residue 105 type BINDING sequence C description BINDING => ECO:0000269|PubMed:28546513, ECO:0007744|PDB:5WZZ source Swiss-Prot : SWS_FT_FI2 12) chain A residue 117 type BINDING sequence H description BINDING => ECO:0000269|PubMed:28546513, ECO:0007744|PDB:5WZZ source Swiss-Prot : SWS_FT_FI2 13) chain A residue 121 type BINDING sequence C description BINDING => ECO:0000269|PubMed:28546513, ECO:0007744|PDB:5WZZ source Swiss-Prot : SWS_FT_FI2 14) chain A residue 128 type BINDING sequence C description BINDING => ECO:0000269|PubMed:16085652, ECO:0000269|PubMed:28546513, ECO:0007744|PDB:2A25, ECO:0007744|PDB:5WZZ source Swiss-Prot : SWS_FT_FI3 15) chain A residue 135 type BINDING sequence C description BINDING => ECO:0000269|PubMed:16085652, ECO:0000269|PubMed:28546513, ECO:0007744|PDB:2A25, ECO:0007744|PDB:5WZZ source Swiss-Prot : SWS_FT_FI3 16) chain A residue 147 type BINDING sequence H description BINDING => ECO:0000269|PubMed:16085652, ECO:0000269|PubMed:28546513, ECO:0007744|PDB:2A25, ECO:0007744|PDB:5WZZ source Swiss-Prot : SWS_FT_FI3 17) chain A residue 152 type BINDING sequence H description BINDING => ECO:0000269|PubMed:16085652, ECO:0000269|PubMed:28546513, ECO:0007744|PDB:2A25, ECO:0007744|PDB:5WZZ source Swiss-Prot : SWS_FT_FI3

Display surface Download Links