eF-site ID 4wu8-D PDB Code 4wu8 Chain D click to enlarge Title Structure of trPtNAP-NCP145 Classification STRUCTURAL PROTEIN/DNA Compound DNA (145-MER) Source Xenopus laevis (African clawed frog) (H2B11_XENLA) Sequence D:  KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVF ERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHA VSEGTKAVTKYTSAK Description Functional site 1) chain D residue 87 type sequence T description binding site for residue SO4 D 201 source : AC3 2) chain D residue 88 type sequence S description binding site for residue SO4 D 201 source : AC3 3) chain D residue 45 type sequence V description binding site for residue MG E 201 source : AC4 4) chain D residue 89-111 type prosite sequence REIQTAVRLLLPGELAKHAVSEG description HISTONE_H2B Histone H2B signature. REIQTavRlLLpGELaKHAVSEG source prosite : PS00357 5) chain D residue 109 type CARBOHYD sequence S description O-linked (GlcNAc) serine => ECO:0000250|UniProtKB:P62807 source Swiss-Prot : SWS_FT_FI3 6) chain D residue 117 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000250|UniProtKB:P0C1H4 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links