eF-site ID 4wrt-A
PDB Code 4wrt
Chain A

click to enlarge
Title Crystal structure of Influenza B polymerase with bound vRNA promoter (form FluB2)
Classification TRANSFERASE/RNA
Compound Influenza virus polymerase vRNA promoter 3' end
Source (Q5V8X3_9INFB)
Sequence A:  SMDTFITRNFQTTIIQKAKNTMAEFSEDPELQPAMLFNIC
VHLEVCYVISDMNFLDEEGKAYTANLRPQYEVIEGMPRTI
AWMVQRSLAQEHGIETPKYLADLFDYKTKRFIEVGITKGL
ADDYFWKKKEKLGNSMELMIFSYNQDYSLSNESSLDEEGK
GRVLSRLTELQAELSLKNLWQVLIGEEDVEKGIDFKLGQT
ISRLRDISVPAGFSNFEGMRSYIDNIDPKGAIERNLARMS
PLVSVTPKKLTWEDLRPIGPHIYNHELPEVPYNAFLLMSD
ELGLANMTEGKSKKPKTLAKECLEKYSTLRDQTDPILIMK
SEKANENFLWKLWRDCVNTISNEEMSNELQKTNYAKWATG
DGLTYQKIMKEVAIDDETMCQEEPKIPNKCRVAAWVQTEM
NLLSTLTSKRALDLPEIGPDVAPVEHVGSERRKYFVNEIN
YCKASTVMMKYVLFHTSLLNESNASMGKYKVIPITNRVVN
EKGESFDMLYGLAVKGQSHLRGDTDVVTVVTFEFSSTDPR
VDSGKWPKYTVFRIGSLFVSGREKSVYLYCRVNGTNKIQM
KWGMEARRCLLQSMQQMEAIVEQESSIQGYDMTKACFKGD
RVNSPKTFSIGTQEGKLVKGSFGKALRVIFTKCLMHYVFG
NAQLEGFSAESRRLLLLIQALKDRKGPWVFDLEGMYSGIE
ECISNNPWVIQSAYWFNEWLGFEKEGSKV
Description (1)  Influenza B PA subunit, Influenza B PB1 subunit, Influenza B PB2 subunit/RNA Complex

Display surface

Download
Links