eF-site ID 4wfb-L
PDB Code 4wfb
Chain L

click to enlarge
Title The crystal structure of the large ribosomal subunit of Staphylococcus aureus in complex with BC-3205
Classification RIBOSOME
Compound 23S rRNA
Source ORGANISM_SCIENTIFIC: Staphylococcus aureus subsp. aureus NCTC 8325;
Sequence L:  MISKIDKNKVRLKRHARVRTNLSGTAEKPRLNVYRSNKHI
YAQIIDDNKGVTLAQASSKDSDIATTATKVELATKVGEAI
AKKAADKGIKEIVFDRGGYLYHGRVKALAE
Description (1)  RNA (2923-MER), RNA (114-MER)

Display surface

Download
Links