eF-site ID 4wfb-A PDB Code 4wfb Chain A click to enlarge Title The crystal structure of the large ribosomal subunit of Staphylococcus aureus in complex with BC-3205 Classification RIBOSOME Compound 23S rRNA Source ORGANISM_SCIENTIFIC: Staphylococcus aureus subsp. aureus NCTC 8325; Sequence A:  IKKYKPITNGRRNMTSLDFAEITKTTPEKSLLKPLPKKAG RNNQGKLTVRHHGGGHKRQYRVIDFKRNKDGINAKVDSIQ YDPNRSANIALVVYADGEKRYIIAPKGLEVGQIVESGAEA DIKVGNALPLQNIPVGTVVHNIELKPGKGGQIARSAGASA QVLGKEGKYVLIRLRSGEVRMILSTCRATIGQVGNLQHEL VNVGKAGRSRWKGIRPTVRGSVMNPNDHPHGGGEGRAPIG RPSPMSPWGKPTLGKKTRRGKKSSDKLIVRG Description Functional site 1) chain A residue 219 type sequence T description binding site for residue MG X 3053 source : AG8 2) chain A residue 16 type sequence M description binding site for residue MG X 3101 source : AL3 3) chain A residue 232 type sequence H description binding site for residue MN X 3306 source : BF6 4) chain A residue 241 type sequence I description binding site for residue MN X 3306 source : BF6 5) chain A residue 227 type sequence P description binding site for residue MN X 3444 source : BQ9 6) chain A residue 235 type sequence G description binding site for residue MG A 302 source : BR9 7) chain A residue 237 type sequence G description binding site for residue MG A 302 source : BR9 8) chain A residue 218-229 type prosite sequence PTVRGSVMNPND description RIBOSOMAL_L2 Ribosomal protein L2 signature. PtvRGSVmNPnD source prosite : PS00467

Display surface Download Links