eF-site ID 4wey-B PDB Code 4wey Chain B click to enlarge Title Crystal structure of E.Coli DsbA in complex with compound 17 Classification OXIDOREDUCTASE/OXIDOREDUCTASE INHIBITOR Compound Thiol:disulfide interchange protein Source ORGANISM_SCIENTIFIC: Escherichia coli BL21(DE3); Sequence B:  AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVL HISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAM ALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGE EYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQ LNPQGMDTSNMDVFVQQYADTVKYLSEK Description Functional site 1) chain B residue 146 type sequence Q description binding site for residue EDO B 201 source : AC1 2) chain B residue 147 type sequence L description binding site for residue EDO B 201 source : AC1 3) chain B residue 147 type sequence L description binding site for residue EDO B 201 source : AC1 4) chain B residue 148 type sequence R description binding site for residue EDO B 201 source : AC1 5) chain B residue 148 type sequence R description binding site for residue EDO B 201 source : AC1 6) chain B residue 64 type sequence M description binding site for residue EG6 B 202 source : AC2 7) chain B residue 65 type sequence G description binding site for residue EG6 B 202 source : AC2 8) chain B residue 68 type sequence L description binding site for residue EG6 B 202 source : AC2

Display surface Download Links