eF-site ID 4wet-A PDB Code 4wet Chain A click to enlarge Title Crystal structure of E.Coli DsbA in complex with compound 16 Classification OXIDOREDUCTASE/OXIDOREDUCTASE INHIBITOR Compound Thiol:disulfide interchange protein Source ORGANISM_SCIENTIFIC: Escherichia coli BL21(DE3); Sequence A:  QYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLH ISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMA LGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEE YDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQL NPQGMDTSNMDVFVQQYADTVKYLSEK Description Functional site 1) chain A residue 32 type sequence H description binding site for residue WEF A 201 source : AC1 2) chain A residue 40 type sequence L description binding site for residue WEF A 201 source : AC1 3) chain A residue 164 type sequence Q description binding site for residue WEF A 201 source : AC1 4) chain A residue 168 type sequence T description binding site for residue WEF A 201 source : AC1 5) chain A residue 170 type sequence N description binding site for residue WEF A 201 source : AC1 6) chain A residue 171 type sequence M description binding site for residue WEF A 201 source : AC1 7) chain A residue 174 type sequence F description binding site for residue WEF A 201 source : AC1 8) chain A residue 22-40 type prosite sequence VLEFFSFFCPHCYQFEEVL description THIOREDOXIN_1 Thioredoxin family active site. VLeFFsfFCPHCYqFeevL source prosite : PS00194

Display surface Download Links