eF-site ID 4wce-2 PDB Code 4wce Chain 2 click to enlarge Title The crystal structure of the large ribosomal subunit of Staphylococcus aureus Classification RIBOSOME Compound 23S rRNA Source ORGANISM_SCIENTIFIC: Staphylococcus aureus; Sequence 2:  VKRTYQPNKRKHSKVHGFRKRMSTKNGRKVLARRRRKGRK VLSA Description Functional site 1) chain 2 residue 3-22 type prosite sequence KRTYQPNKRKHSKVHGFRKR description RIBOSOMAL_L34 Ribosomal protein L34 signature. KRTYQpnkrkHskvh.GFrkR source prosite : PS00784

Display surface Download Links