eF-site ID 4w6r-I
PDB Code 4w6r
Chain I

click to enlarge
Title Crystal Structure of Full-Length Split GFP Mutant D102C Disulfide Dimer, P 1 Space Group
Classification FLUORESCENT PROTEIN
Compound fluorescent protein D102C
Source (4W6R)
Sequence I:  GEELFTGVVPILIELDGDVNGHKFFVRGEGEGDATIGKLS
LKFIATTGKLPVPWPTLVTTLVQCFSRYPDHMKRHDFFKS
AMPEGYVQERTIYFKCDGTYKTRAEVGDTLVNRIELKGID
FKNILGHKLEYNFNSHKVYITADKQNNGIKANFTIRHNVE
DGSVQLADHYQQNTPIGLPDDHYLSTQTILSKDLNEKRDH
MVLLEYVTA
Description (1)  fluorescent protein D102C

Display surface

Download
Links