eF-site ID 4w6r-ABCDEFGHIJKLMNOP
PDB Code 4w6r
Chain A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
Title Crystal Structure of Full-Length Split GFP Mutant D102C Disulfide Dimer, P 1 Space Group
Classification FLUORESCENT PROTEIN
Compound fluorescent protein D102C
Source (4W6R)
Sequence A:  LFTGVVPILIELDGDVNGHKFFVRGEGEGDATIGKLSLKF
IATTGKLPVPWPTLVTTLVQCFSRYPDHMKRHDFFKSAMP
EGYVQERTIYFKCDGTYKTRAEVKFEGDTLVNRIELKGID
FKEDGNILGHLEYNFNSHKVYITADKQNNGIKANFTIRHN
VEDGSVQLADHYQQNTPIGDPVDLPDDHYLSTQTILSKDL
NEKRDHMVLLEYVTA
B:  ELFTGVVPILIELDGDVNGHKFFVRGEGEATIGKLSLKFI
ATTGKLPVPWPTLVTTLVQCYPDHMKRHDFFKSAPEGYVQ
ERTIYFKCDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDG
NILGHKLEYNFNSHKVYITADKQNNGIKANFTIRHNVEDG
SVQLADHYQQNTPIGDDHYLSTQTILSKDLNEKRDHMVLL
EYVTA
C:  GEELFTGVVPILIELDGDVNGHKFFVRGEGEGDATIGKLS
LKFIATTGKLPVPWPTLVTTLVQCFSRYPMKRHDFFKSAM
PEGYVQERTIYFKCDGTYKTRAEVKFEGDTLVNRIELKGI
DFDGNILGHKLEYNFNSHKVYITADKQNNGIKANFTIRHN
VEDGSVQLADHYQQNTPIGHYLSTQTILSKDLRDHMVLLE
YVTAAGI
D:  GEELFTGVVLIELDGDVNGHKFFGEGDATIGKLSLFIATT
GKLPVPWPTLVTTLVQCFSRYPDHMKRHDFFKSAMTIYFK
CDGTYKTREVKFEGDTLVNRIELKGIDFKEDGNILGHKLE
YNFNSHKVYITADKQNIKANFTIRHNVEDGSVQLADHYQQ
NTPIGLPDDHYLSTQTILSKRDHMVLLEYVTAAG
E:  GEELFTGVVPILIELDGDVNGHKFFVRGEGEGDATIGKLS
LKFIATTGKLPVPWPTLVTTLVQCFSRYPDHMKFKSAMPE
GYVQERTIYFKCDGTYKTRAEVKFTLVNRIELKGIDFKED
GNILGHKLEYNFNSHKVYITADKQNNGIKANFTIRHNVED
GSVQLADHYQQNTPDLPDDHYLSTQTILSKDLNEKRDHMV
LLEYVTAA
F:  GEELFTGVVPILIELDGDVNGHKFFVRGEGEGDATIGKLS
LKFIATTGKLPVPWPTLVTTLVQCFSRYPDHDFFKSAMPE
GYVQERTIYFKCDGTYKTRAEVVNRIELKGIDFKEDGNIL
GHKLEYNFNSHKVYITADKQNNGIKANFTIRHNGSVQLAD
HYQQNTPIGDGPPDDHYLSTQTILSKDLNEKRDVLLEYVT
A
G:  LFTGVVPILIELDGDVNGHKFFVRGEGEGDATIGKLSLKF
IATTGKLPVPWPTLVVQCFSRDHMKRHDFFVQERTIYFKC
DGTYKTRAEVKFEGDTLVNRIELGHKLEYNFNSHKVYITA
DKQNNGIKANFTIRHNVEDGSVQLADHYQQNTPIPDDHYL
STQTILSKDLNEKRDHMVLLEYVTAAGI
H:  VPILIELDGDVNGHKFFVRGEGEGATIGKLSLKFILPVPW
PTLVTTLVQCFSRYPDHMKRHDFFKSPEGYVQERTIYFKC
DGTYKTRAEVKDTLVNRIELKGIDFKEDGNILGHKLEYNF
NSHKVYITADKQNNGIKANFTIRHNVEDGSVQLADHYQQN
TPIGVDLPDDHYLSTQTIRDHMVLLEYVTAA
I:  GEELFTGVVPILIELDGDVNGHKFFVRGEGEGDATIGKLS
LKFIATTGKLPVPWPTLVTTLVQCFSRYPDHMKRHDFFKS
AMPEGYVQERTIYFKCDGTYKTRAEVGDTLVNRIELKGID
FKNILGHKLEYNFNSHKVYITADKQNNGIKANFTIRHNVE
DGSVQLADHYQQNTPIGLPDDHYLSTQTILSKDLNEKRDH
MVLLEYVTA
J:  ELFTGVVPILIELDGDVNGHKFFVRGEGEGDATIGSLKFI
ATTGKLPVPWPTLVTTLVQCFSRYPDHVQERTIYFKCTYK
TRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNS
HKVADKQNNGIKANFTIRHNVEDGSVQLADHYQQNTPIGD
HYLSTQTILSKDLMVLLEYVTAAG
K:  LFTGVVPILIELDGDVNGHKFFVATIGKLSLKFIATTGKL
PVPWPTLVTTLVQCFSDFFKSAMPEGYVQERTIYFKCDGT
YKTRAELVNRIELKGIDFKEDGNILGHKLEYNFNSHKVYI
TADKQNNGIKANFTIRHNVEDGSVQLADHYQQNTPIGDDL
PDDHYTILEYVTAAG
L:  PILIELDGDVNGHKFFVRGEGEGDALKFIATTGKLPVPWP
TLVTTLVQCFSKRHDFFKSAMPEGYVQERTIYFKCDGTYK
TRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNS
HKVYITADKQNNGIKANFTIRHNVEDGSVQLADHYQQNTP
IGDGPLPDDHYLSTQTILSKDLNEKRDHMVLLEYVTA
M:  ELFTGVVPILIELDGDVNGHKFFVRGEGSLKFIATTVPWP
TLVTTLVQCFSRYPDHMKRRTIYFKCDGTYKTRAEDTLVN
RIELKGIDFKILGHKLEYNFNSHKVYITADKQNNGIKANF
TIRHNVEDGSVQLADHYQLSTQTILSKDLNEKRDHMVLLE
YVTAAGIT
N:  LIELDGDVNGHKGEGDATIGKLSLKFIAPVPWPTLVTTLS
AMPEGYVQERTIYFKCDGTYKTRAEVKFEGDTLVNRIELK
GIDFKEDGNILGHKLEYNFNSHKVYITADKQNNGIKANFT
IRHNVEDGSVQLDHYQQNTPIGDPDDHYLSTQTILSKDLN
EKRDHMVLLEYVTA
O:  GEELFTGVVPILIELDGDVNGHKFFVRGEGEGDATIGKLS
LKFIATTGKLPVPWPTLVTTLYPDHMKRHDFFKSAMPEGY
VQERTIYFKCDGTYKTRAEVKFEGDTLVNRIELKGIDFKE
DGNILGHKLEYNFNSHKVYITADKQNNGIKANFTIRHNVE
DGSVQLADHYQQNTPIGDGDLPDDHYLSTQTILSKDLNEK
RDHMVLLEYVTAA
P:  FTGVVPILIELDGDVNGHKFFVRGEGEGDATIGKLSLKFI
ATTGKLPVPWPTLVTTLVQCFSRYPDHMKRHDFFKSAMGY
VQERTIYFKCDGTYKTRAEVKFEGDTLVNRIELKGIDFKE
DGNILGHKLEYNFNSHKVYITADKQNNGKANFTIRHNVED
GSVQLADHYQQNLPDDHYLSQTILSKDLNEKRDHMVLLEY
VTAA
Description (1)  fluorescent protein D102C

Display surface

Download
Links