eF-site ID 4uy4-BD
PDB Code 4uy4
Chain B, D

click to enlarge
Title 1.86 A structure of human Spindlin-4 protein in complex with histone H3K4me3 peptide
Classification PEPTIDE BINDING PROTEIN
Compound SPINDLIN-4
Source Homo sapiens (Human) (4UY4)
Sequence B:  SMTRRNIVGCRIQHGWKEGNEPVEQWKGTVLEQVSVKPTL
YIIKYDGKDSVYGLELHRDKRVLALEILPERVPTPRIDSR
LADSLIGKAVEHVFEGEHGTKDEWKGMVLARAPVMDTWFY
ITYEKDPVLYMYTLLDDYKDGDLRIIPDSNYYFPTAEQED
SLVGKQVEHAKDDGSKRTGIFIHQVVAKPSVYFIKFDDDI
HIYVYGLV
D:  ARTXQT
Description (1)  SPINDLIN-4, HISTONE H3K4ME3


Functional site

1) chain B
residue 126
type BINDING
ligand
sequence V
description Histone H3K4me3 and H3R8me2a. {ECO:0000250|UniProtKB:Q9Y657}.
source Swiss-Prot : SWS_FT_FI2

2) chain B
residue 137
type BINDING
ligand
sequence W
description Histone H3K4me3 and H3R8me2a. {ECO:0000250|UniProtKB:Q9Y657}.
source Swiss-Prot : SWS_FT_FI2

3) chain B
residue 127-128
type binding
ligand M3L: N-TRIMETHYLLYSINE
sequence FE
description N-TRIMETHYLLYSINE binding site
source pdb_hetatom : M3L_4uy4_D_4

4) chain B
residue 137
type binding
ligand M3L: N-TRIMETHYLLYSINE
sequence W
description N-TRIMETHYLLYSINE binding site
source pdb_hetatom : M3L_4uy4_D_4

5) chain B
residue 156
type binding
ligand M3L: N-TRIMETHYLLYSINE
sequence Y
description N-TRIMETHYLLYSINE binding site
source pdb_hetatom : M3L_4uy4_D_4

6) chain B
residue 159
type binding
ligand M3L: N-TRIMETHYLLYSINE
sequence D
description N-TRIMETHYLLYSINE binding site
source pdb_hetatom : M3L_4uy4_D_4

7) chain B
residue 163
type binding
ligand M3L: N-TRIMETHYLLYSINE
sequence Y
description N-TRIMETHYLLYSINE binding site
source pdb_hetatom : M3L_4uy4_D_4

8) chain B
residue 165
type binding
ligand M3L: N-TRIMETHYLLYSINE
sequence Y
description N-TRIMETHYLLYSINE binding site
source pdb_hetatom : M3L_4uy4_D_4

9) chain D
residue 2-3
type binding
ligand M3L: N-TRIMETHYLLYSINE
sequence RT
description N-TRIMETHYLLYSINE binding site
source pdb_hetatom : M3L_4uy4_D_4

10) chain D
residue 5-6
type binding
ligand M3L: N-TRIMETHYLLYSINE
sequence QT
description N-TRIMETHYLLYSINE binding site
source pdb_hetatom : M3L_4uy4_D_4


Display surface

Download
Links