eF-site ID 4up6-A
PDB Code 4up6
Chain A

click to enlarge
Title Crystal structure of the wild-type diacylglycerol kinase refolded in the lipid cubic phase
Classification TRANSFERASE
Compound DIACYLGLYCEROL KINASE
Source (KDGL_ECOLI)
Sequence A:  FTRIIKAAGYSWKGLRAAWINEAAFRQEGVAVLLAVVIAC
WLDVDAITRVLLISSVMLVMIVEILNSAIEAVVDRIGSEY
HELSGRAKDMGSAAVLIAIIVAVITWCILLWSHF
Description (1)  DIACYLGLYCEROL KINASE (E.C.2.7.1.107)


Functional site

1) chain A
residue 69-80
type prosite
ligand
sequence EILNSAIEAVVD
description Prokaryotic diacylglycerol kinase signature.E-x-[LIVM]-N-[ST]-[SA]-[LIV]-E-x(2)-V-D.
source prosite : PS01069


Display surface

Download
Links