eF-site ID 4un8-G
PDB Code 4un8
Chain G

click to enlarge
Title THE CRYSTAL STRUCTURE OF I-DMOI IN COMPLEX WITH ITS TARGET DNA AT 1H INCUBATION IN 5MM MN (STATE 2)
Classification HYDROLASE/DNA
Compound HOMING ENDONUCLEASE I-DMOI
Source Desulfurococcus mobilis (4UN8)
Sequence G:  EEVSGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITQKS
ENLIKQHIAPLMQFLIDELNVKSKIQIVKGDTRYELRVSS
KKLYYYFANMLERIRLFNMREQIAFIKGLYVAEGDKTLKR
LRIWNKNKALLEIVSRWLNNLGVRNTIHLDDHRHGVYVLN
ISLRDRIKFVHTILSSH
Description (1)  HOMING ENDONUCLEASE I-DMOI (E.C.3.1.-.-)


Functional site

1) chain G
residue 20
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MN G 1182
source : AC5

2) chain G
residue 117
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN G 1182
source : AC5

3) chain G
residue 21
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN G 1183
source : AC6

4) chain G
residue 116
type
ligand
sequence A
description BINDING SITE FOR RESIDUE MN G 1183
source : AC6

5) chain G
residue 21
type ACT_SITE
ligand
sequence D
description
source Swiss-Prot : SWS_FT_FI3

6) chain G
residue 117
type ACT_SITE
ligand
sequence E
description
source Swiss-Prot : SWS_FT_FI3


Display surface

Download
Links