eF-site ID 4un8-D
PDB Code 4un8
Chain D

click to enlarge
Title THE CRYSTAL STRUCTURE OF I-DMOI IN COMPLEX WITH ITS TARGET DNA AT 1H INCUBATION IN 5MM MN (STATE 2)
Classification HYDROLASE/DNA
Compound HOMING ENDONUCLEASE I-DMOI
Source Desulfurococcus mobilis (4UN8)
Sequence D:  ENVSGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITQKS
ENLIKQHIAPLMQFLIDELNVKSKIQIVKGDTRYELRVSS
KKLYYYFANMLERIRLFNMREQIAFIKGLYVAEGDKTLKR
LRIWNKNKALLEIVSRWLNNLGVRNTIHLDDHRHGVYVLN
ISLRDRIKFVHTILSSHLNPLPPEAAALEHH
Description (1)  HOMING ENDONUCLEASE I-DMOI (E.C.3.1.-.-)


Functional site

1) chain D
residue 21
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN D 1197
source : AC3

2) chain D
residue 116
type
ligand
sequence A
description BINDING SITE FOR RESIDUE MN D 1197
source : AC3

3) chain D
residue 20
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MN D 1198
source : AC4

4) chain D
residue 117
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN D 1198
source : AC4

5) chain D
residue 21
type ACT_SITE
ligand
sequence D
description
source Swiss-Prot : SWS_FT_FI2

6) chain D
residue 117
type ACT_SITE
ligand
sequence E
description
source Swiss-Prot : SWS_FT_FI2


Display surface

Download
Links