eF-site ID 4un8-ABCDEFGHI
PDB Code 4un8
Chain A, B, C, D, E, F, G, H, I

click to enlarge
Title THE CRYSTAL STRUCTURE OF I-DMOI IN COMPLEX WITH ITS TARGET DNA AT 1H INCUBATION IN 5MM MN (STATE 2)
Classification HYDROLASE/DNA
Compound HOMING ENDONUCLEASE I-DMOI
Source Desulfurococcus mobilis (4UN8)
Sequence A:  NENVSGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITQK
SENLIKQHIAPLMQFLIDELNVKSKIQIVKGDTRYELRVS
SKKLYYYFANMLERIRLFNMREQIAFIKGLYVAEGDKTLK
RLRIWNKNKALLEIVSRWLNNLGVRNTIHLDDHRHGVYVL
NISLRDRIKFVHTILSSHLNPLPP
B:  GCCTTGCCGGGTAAGTTCCGGCGCG
C:  CGCGCCGGAACTTACCCGGCAAGGC
D:  ENVSGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITQKS
ENLIKQHIAPLMQFLIDELNVKSKIQIVKGDTRYELRVSS
KKLYYYFANMLERIRLFNMREQIAFIKGLYVAEGDKTLKR
LRIWNKNKALLEIVSRWLNNLGVRNTIHLDDHRHGVYVLN
ISLRDRIKFVHTILSSHLNPLPPEAAALEHH
E:  GCCTTGCCGGGTAAGTTCCGGCGCG
F:  CGCGCCGGAACTTACCCGGCAAGGC
G:  EEVSGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITQKS
ENLIKQHIAPLMQFLIDELNVKSKIQIVKGDTRYELRVSS
KKLYYYFANMLERIRLFNMREQIAFIKGLYVAEGDKTLKR
LRIWNKNKALLEIVSRWLNNLGVRNTIHLDDHRHGVYVLN
ISLRDRIKFVHTILSSH
H:  GCCTTGCCGGGTAAGTTCCGGCGCG
I:  CGCGCCGGAACTTACCCGGCAAGGC
Description (1)  HOMING ENDONUCLEASE I-DMOI (E.C.3.1.-.-)


Functional site

1) chain A
residue 21
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN A 1188
source : AC1

2) chain A
residue 116
type
ligand
sequence A
description BINDING SITE FOR RESIDUE MN A 1188
source : AC1

3) chain A
residue 120
type
ligand
sequence K
description BINDING SITE FOR RESIDUE MN A 1188
source : AC1

4) chain B
residue 14
type
ligand
sequence A
description BINDING SITE FOR RESIDUE MN A 1188
source : AC1

5) chain C
residue 16
type
ligand
sequence C
description BINDING SITE FOR RESIDUE MN A 1188
source : AC1

6) chain A
residue 20
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MN A 1189
source : AC2

7) chain A
residue 117
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN A 1189
source : AC2

8) chain B
residue 15
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MN A 1189
source : AC2

9) chain C
residue 15
type
ligand
sequence C
description BINDING SITE FOR RESIDUE MN A 1189
source : AC2

10) chain D
residue 21
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN D 1197
source : AC3

11) chain D
residue 116
type
ligand
sequence A
description BINDING SITE FOR RESIDUE MN D 1197
source : AC3

12) chain E
residue 14
type
ligand
sequence A
description BINDING SITE FOR RESIDUE MN D 1197
source : AC3

13) chain F
residue 16
type
ligand
sequence C
description BINDING SITE FOR RESIDUE MN D 1197
source : AC3

14) chain D
residue 20
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MN D 1198
source : AC4

15) chain D
residue 117
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN D 1198
source : AC4

16) chain E
residue 15
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MN D 1198
source : AC4

17) chain F
residue 15
type
ligand
sequence C
description BINDING SITE FOR RESIDUE MN D 1198
source : AC4

18) chain G
residue 20
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MN G 1182
source : AC5

19) chain G
residue 117
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN G 1182
source : AC5

20) chain H
residue 15
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MN G 1182
source : AC5

21) chain I
residue 15
type
ligand
sequence C
description BINDING SITE FOR RESIDUE MN G 1182
source : AC5

22) chain G
residue 21
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN G 1183
source : AC6

23) chain G
residue 116
type
ligand
sequence A
description BINDING SITE FOR RESIDUE MN G 1183
source : AC6

24) chain H
residue 14
type
ligand
sequence A
description BINDING SITE FOR RESIDUE MN G 1183
source : AC6

25) chain I
residue 16
type
ligand
sequence C
description BINDING SITE FOR RESIDUE MN G 1183
source : AC6

26) chain A
residue 21
type ACT_SITE
ligand
sequence D
description
source Swiss-Prot : SWS_FT_FI1

27) chain A
residue 117
type ACT_SITE
ligand
sequence E
description
source Swiss-Prot : SWS_FT_FI1

28) chain D
residue 21
type ACT_SITE
ligand
sequence D
description
source Swiss-Prot : SWS_FT_FI2

29) chain D
residue 117
type ACT_SITE
ligand
sequence E
description
source Swiss-Prot : SWS_FT_FI2

30) chain G
residue 21
type ACT_SITE
ligand
sequence D
description
source Swiss-Prot : SWS_FT_FI3

31) chain G
residue 117
type ACT_SITE
ligand
sequence E
description
source Swiss-Prot : SWS_FT_FI3


Display surface

Download
Links