eF-site ID 4un8-A
PDB Code 4un8
Chain A

click to enlarge
Title THE CRYSTAL STRUCTURE OF I-DMOI IN COMPLEX WITH ITS TARGET DNA AT 1H INCUBATION IN 5MM MN (STATE 2)
Classification HYDROLASE/DNA
Compound HOMING ENDONUCLEASE I-DMOI
Source Desulfurococcus mobilis (4UN8)
Sequence A:  NENVSGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITQK
SENLIKQHIAPLMQFLIDELNVKSKIQIVKGDTRYELRVS
SKKLYYYFANMLERIRLFNMREQIAFIKGLYVAEGDKTLK
RLRIWNKNKALLEIVSRWLNNLGVRNTIHLDDHRHGVYVL
NISLRDRIKFVHTILSSHLNPLPP
Description (1)  HOMING ENDONUCLEASE I-DMOI (E.C.3.1.-.-)


Functional site

1) chain A
residue 21
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN A 1188
source : AC1

2) chain A
residue 116
type
ligand
sequence A
description BINDING SITE FOR RESIDUE MN A 1188
source : AC1

3) chain A
residue 120
type
ligand
sequence K
description BINDING SITE FOR RESIDUE MN A 1188
source : AC1

4) chain A
residue 20
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MN A 1189
source : AC2

5) chain A
residue 117
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN A 1189
source : AC2

6) chain A
residue 21
type ACT_SITE
ligand
sequence D
description
source Swiss-Prot : SWS_FT_FI1

7) chain A
residue 117
type ACT_SITE
ligand
sequence E
description
source Swiss-Prot : SWS_FT_FI1


Display surface

Download
Links