eF-site ID 4u73-A PDB Code 4u73 Chain A click to enlarge Title HsMetAP(F309M) IN COMPLEX WITH (amino(phenyl)methyl)phosphonic acid Classification HYDROLASE Compound Methionine aminopeptidase 1 Source (MAP11_HUMAN) Sequence A:  YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQ ALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPG VTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEV ICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGE VDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHA QANGFSVVRSYCGHGIHKLMHTAPNVPHYAKNKAVGVMKS GHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHT LLVTDTGCEILTRRLDSARPHFMS Description Functional site 1) chain A residue 240 type sequence D description binding site for residue CO A 401 source : AC1 2) chain A residue 303 type sequence H description binding site for residue CO A 401 source : AC1 3) chain A residue 336 type sequence E description binding site for residue CO A 401 source : AC1 4) chain A residue 367 type sequence E description binding site for residue CO A 401 source : AC1 5) chain A residue 229 type sequence D description binding site for residue CO A 402 source : AC2 6) chain A residue 240 type sequence D description binding site for residue CO A 402 source : AC2 7) chain A residue 367 type sequence E description binding site for residue CO A 402 source : AC2 8) chain A residue 207 type sequence N description binding site for residue K A 403 source : AC3 9) chain A residue 209 type sequence V description binding site for residue K A 403 source : AC3 10) chain A residue 363 type sequence S description binding site for residue K A 403 source : AC3 11) chain A residue 195 type sequence Y description binding site for residue Q02 A 404 source : AC4 12) chain A residue 212 type sequence H description binding site for residue Q02 A 404 source : AC4 13) chain A residue 229 type sequence D description binding site for residue Q02 A 404 source : AC4 14) chain A residue 231 type sequence T description binding site for residue Q02 A 404 source : AC4 15) chain A residue 240 type sequence D description binding site for residue Q02 A 404 source : AC4 16) chain A residue 303 type sequence H description binding site for residue Q02 A 404 source : AC4 17) chain A residue 310 type sequence H description binding site for residue Q02 A 404 source : AC4 18) chain A residue 336 type sequence E description binding site for residue Q02 A 404 source : AC4 19) chain A residue 367 type sequence E description binding site for residue Q02 A 404 source : AC4 20) chain A residue 300-318 type prosite sequence YCGHGIHKLMHTAPNVPHY description MAP_1 Methionine aminopeptidase subfamily 1 signature. YcGHGIHklmHtapnVp.HY source prosite : PS00680 21) chain A residue 212 type BINDING sequence H description BINDING => ECO:0000255|HAMAP-Rule:MF_03174, ECO:0000269|PubMed:16724298, ECO:0000269|PubMed:16823043, ECO:0000269|PubMed:17114291 source Swiss-Prot : SWS_FT_FI1 22) chain A residue 310 type BINDING sequence H description BINDING => ECO:0000255|HAMAP-Rule:MF_03174, ECO:0000269|PubMed:16724298, ECO:0000269|PubMed:16823043, ECO:0000269|PubMed:17114291 source Swiss-Prot : SWS_FT_FI1 23) chain A residue 229 type BINDING sequence D description BINDING => ECO:0000255|HAMAP-Rule:MF_03174, ECO:0000269|PubMed:16274222, ECO:0000269|PubMed:16724298, ECO:0000269|PubMed:16823043, ECO:0000269|PubMed:17114291 source Swiss-Prot : SWS_FT_FI2 24) chain A residue 240 type BINDING sequence D description BINDING => ECO:0000255|HAMAP-Rule:MF_03174, ECO:0000269|PubMed:16274222, ECO:0000269|PubMed:16724298, ECO:0000269|PubMed:16823043, ECO:0000269|PubMed:17114291 source Swiss-Prot : SWS_FT_FI2 25) chain A residue 303 type BINDING sequence H description BINDING => ECO:0000255|HAMAP-Rule:MF_03174, ECO:0000269|PubMed:16274222, ECO:0000269|PubMed:16724298, ECO:0000269|PubMed:16823043, ECO:0000269|PubMed:17114291 source Swiss-Prot : SWS_FT_FI2 26) chain A residue 336 type BINDING sequence E description BINDING => ECO:0000255|HAMAP-Rule:MF_03174, ECO:0000269|PubMed:16274222, ECO:0000269|PubMed:16724298, ECO:0000269|PubMed:16823043, ECO:0000269|PubMed:17114291 source Swiss-Prot : SWS_FT_FI2 27) chain A residue 367 type BINDING sequence E description BINDING => ECO:0000255|HAMAP-Rule:MF_03174, ECO:0000269|PubMed:16274222, ECO:0000269|PubMed:16724298, ECO:0000269|PubMed:16823043, ECO:0000269|PubMed:17114291 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links