eF-site ID 4u6b-D PDB Code 4u6b Chain D click to enlarge Title Zg3597, a family 117 glycoside hydrolase, produced by the marine bacterium Zobellia galactanivorans Classification HYDROLASE Compound Conserved hypothetical lipoprotein Source Zobellia galactanivorans (strain DSM 12802 / CIP 106680 / NCIMB 13871 / Dsij) (F0V1E1_ZOBGA) Sequence D:  DNELFSQFKYTRLKGFDYNNGDGTISRRDPSRPILVNGKY YIYYTKRDTKVPPIGWNRAKEATDEIPSTDWDLCEIWYAT SEDGTTWKEEGVAIARPEKPKPGWRSVATPDILVWKGKYY LYYQAFNEPSGLRGDWCPVSVSYADSPDGPWTHGGDSVIP FGKKGEWDQDATHDPQPIVYKGKIHLYYKAAYNKYAVGHG LAIADDPLGPFEKHPLNPVMTSGHETTYFPFKEGVATLAI KDGNERYTMQYAKDGVNFEIASVVSLAPTAAAPFAADAFT DSGNGRGVTWGLCHFTNASNNPKKGYSIIARFDCDLSLDV DDPFYKNTGVWHRPEVYFAQAPR Description Functional site 1) chain D residue 78 type sequence E description binding site for residue CA D 501 source : AD9 2) chain D residue 397 type sequence D description binding site for residue CA D 501 source : AD9 3) chain D residue 399 type sequence S description binding site for residue CA D 501 source : AD9 4) chain D residue 402 type sequence V description binding site for residue CA D 501 source : AD9 5) chain D residue 87 type sequence R description binding site for residue EDO D 503 source : AE2 6) chain D residue 153 type sequence Y description binding site for residue EDO D 504 source : AE3 7) chain D residue 165 type sequence E description binding site for residue EDO D 504 source : AE3 8) chain D residue 167 type sequence V description binding site for residue EDO D 504 source : AE3 9) chain D residue 123 type sequence D description binding site for residue EDO D 505 source : AE4

Display surface Download Links