eF-site ID 4tu6-ABCD PDB Code 4tu6 Chain A, B, C, D click to enlarge Title Crystal structure of apo ATAD2A bromodomain with N1064 alternate conformation Classification GENE REGULATION Compound ATPase family AAA domain-containing protein 2 Source Homo sapiens (Human) (ATAD2_HUMAN) Sequence A:  SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEV PDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICS NALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFE QLCEEIQESR B:  SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEV PDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICS NALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFE QLCEEIQESR C:  MQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVP DYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSN ALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQ LCEEIQES D:  SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEV PDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICS NALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFE QLCEEIQESR Description Functional site 1) chain A residue 987 type sequence R description binding site for residue SO4 A 1201 source : AC1 2) chain A residue 990 type sequence R description binding site for residue SO4 A 1201 source : AC1 3) chain A residue 994 type sequence R description binding site for residue SO4 A 1201 source : AC1 4) chain B residue 987 type sequence R description binding site for residue SO4 B 1201 source : AC2 5) chain B residue 990 type sequence R description binding site for residue SO4 B 1201 source : AC2 6) chain B residue 994 type sequence R description binding site for residue SO4 B 1201 source : AC2 7) chain C residue 987 type sequence R description binding site for residue SO4 C 1201 source : AC3 8) chain C residue 990 type sequence R description binding site for residue SO4 C 1201 source : AC3 9) chain C residue 994 type sequence R description binding site for residue SO4 C 1201 source : AC3 10) chain D residue 987 type sequence R description binding site for residue SO4 D 1201 source : AC4 11) chain D residue 990 type sequence R description binding site for residue SO4 D 1201 source : AC4 12) chain D residue 994 type sequence R description binding site for residue SO4 D 1201 source : AC4 13) chain D residue 1041 type sequence H description binding site for residue SO4 D 1201 source : AC4

Display surface Download Links