eF-site ID 4tn2-A PDB Code 4tn2 Chain A click to enlarge Title NS5b in complex with lactam-thiophene carboxylic acids Classification HYDROLASE Compound Genome polyprotein Source ORGANISM_COMMON: isolate BK, HCV; ORGANISM_SCIENTIFIC: Hepatitis B virus; Sequence A:  ASYTWTGALITPCAAEESKLPINALSNSLLRHHNMVYATT SRSAGLRQKKVTFDRLQVLDDHYRDVLKEMKAKASTVKAK LLSVEEACKLTPPHSAKSKFGYGAKDVRNLSSKAVNHIHS VWKDLLEDTVTPIDTTIMAKNEVFCVQRKPARLIVFPDLG VRVCEKMALYDVVSTLPQVVMGSSYGFQYSPGQRVEFLVN TWKSKKNPMGFSYDTRCFDSTVTENDIRVEESIYQCCDLA PEARQAIKSLTERLYIGGPLTNSKGQNCGYRRCRASGVLT TSCGNTLTCYLKASAACRAAKLQDCTMLVNGDDLVVICES AGVQEDAASLRAFTEAMTRYSAPPGDPPQPEYDLELITSC SSNVSVAHDASGKRVYYLTRDPTTPLARAAWETARHTPVN SWLGNIIMYAPTLWARMILMTHFFSILLAQEQLEKALDCQ IYGACYSIEPLDLPQIIERLHGLSAFSLHSYSPGEINRVA SCLRKLGVPPLRVWRHRARSVRARLLSQGGRAATCGKYLF NWAVKTKLKLFQGPAASQLDLSGWFVAGYSGGDIYHSLSR A Description Functional site 1) chain A residue 419 type sequence L description binding site for residue 33J A 900 source : AC1 2) chain A residue 422 type sequence R description binding site for residue 33J A 900 source : AC1 3) chain A residue 423 type sequence M description binding site for residue 33J A 900 source : AC1 4) chain A residue 474 type sequence L description binding site for residue 33J A 900 source : AC1 5) chain A residue 475 type sequence H description binding site for residue 33J A 900 source : AC1 6) chain A residue 476 type sequence S description binding site for residue 33J A 900 source : AC1 7) chain A residue 477 type sequence Y description binding site for residue 33J A 900 source : AC1 8) chain A residue 482 type sequence I description binding site for residue 33J A 900 source : AC1 9) chain A residue 497 type sequence L description binding site for residue 33J A 900 source : AC1 10) chain A residue 528 type sequence W description binding site for residue 33J A 900 source : AC1 11) chain A residue 220 type BINDING sequence D description BINDING => ECO:0000305|PubMed:10557268, ECO:0000305|PubMed:11884572 source Swiss-Prot : SWS_FT_FI1 12) chain A residue 318 type BINDING sequence D description BINDING => ECO:0000305|PubMed:10557268, ECO:0000305|PubMed:11884572 source Swiss-Prot : SWS_FT_FI1 13) chain A residue 319 type BINDING sequence D description BINDING => ECO:0000305|PubMed:10557268, ECO:0000305|PubMed:11884572 source Swiss-Prot : SWS_FT_FI1 14) chain A residue 29 type MOD_RES sequence S description Phosphoserine; by host => ECO:0000250|UniProtKB:P26662 source Swiss-Prot : SWS_FT_FI2 15) chain A residue 42 type MOD_RES sequence S description Phosphoserine; by host => ECO:0000250|UniProtKB:P26662 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links