eF-site ID 4tl6-A PDB Code 4tl6 Chain A click to enlarge Title Crystal structure of N-terminal domain of KaiC Classification TRANSFERASE Compound Circadian clock protein kinase KaiC Source (KAIC_SYNE7) Sequence A:  HQAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTL FSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDL AKLVDEGKLFILDASPDPFDLSALIERINYAIQKYRARRV SIDSDASSVVRRELFRLVARLKQIGATTVMTTERIEEYGP IARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSH MKGEYPFTITDHGINIFPLGAM Description Functional site 1) chain A residue 48 type sequence S description binding site for residue ANP A 301 source : AC1 2) chain A residue 49 type sequence G description binding site for residue ANP A 301 source : AC1 3) chain A residue 50 type sequence T description binding site for residue ANP A 301 source : AC1 4) chain A residue 51 type sequence G description binding site for residue ANP A 301 source : AC1 5) chain A residue 52 type sequence K description binding site for residue ANP A 301 source : AC1 6) chain A residue 53 type sequence T description binding site for residue ANP A 301 source : AC1 7) chain A residue 54 type sequence L description binding site for residue ANP A 301 source : AC1 8) chain A residue 89 type sequence S description binding site for residue ANP A 301 source : AC1 9) chain A residue 90 type sequence F description binding site for residue ANP A 301 source : AC1 10) chain A residue 218 type sequence R description binding site for residue ANP A 301 source : AC1 11) chain A residue 239 type sequence I description binding site for residue ANP A 301 source : AC1 12) chain A residue 240 type sequence T description binding site for residue ANP A 301 source : AC1 13) chain A residue 241 type sequence D description binding site for residue ANP A 301 source : AC1 14) chain A residue 53 type sequence T description binding site for residue MG A 302 source : AC2 15) chain A residue 218 type sequence R description binding site for residue CL A 303 source : AC3 16) chain A residue 239 type sequence I description binding site for residue CL A 303 source : AC3 17) chain A residue 199 type sequence F description binding site for residue ANP C 301 source : AC7 18) chain A residue 224 type sequence K description binding site for residue ANP C 301 source : AC7 19) chain A residue 225 type sequence L description binding site for residue ANP C 301 source : AC7 20) chain A residue 226 type sequence R description binding site for residue ANP C 301 source : AC7 21) chain A residue 228 type sequence T description binding site for residue ANP C 301 source : AC7 22) chain A residue 230 type sequence H description binding site for residue ANP C 301 source : AC7 23) chain A residue 49 type BINDING sequence G description BINDING => ECO:0000255|HAMAP-Rule:MF_01836, ECO:0000269|PubMed:15304218, ECO:0000269|PubMed:16628225, ECO:0000269|PubMed:22304631, ECO:0007744|PDB:1TF7, ECO:0007744|PDB:2GBL, ECO:0007744|PDB:4DUG source Swiss-Prot : SWS_FT_FI2 24) chain A residue 230 type BINDING sequence H description BINDING => ECO:0000255|HAMAP-Rule:MF_01836, ECO:0000269|PubMed:15304218, ECO:0000269|PubMed:16628225, ECO:0000269|PubMed:22304631, ECO:0007744|PDB:1TF7, ECO:0007744|PDB:2GBL, ECO:0007744|PDB:4DUG source Swiss-Prot : SWS_FT_FI2 25) chain A residue 240 type BINDING sequence T description BINDING => ECO:0000255|HAMAP-Rule:MF_01836, ECO:0000269|PubMed:15304218, ECO:0000269|PubMed:16628225, ECO:0000269|PubMed:22304631, ECO:0007744|PDB:1TF7, ECO:0007744|PDB:2GBL, ECO:0007744|PDB:4DUG source Swiss-Prot : SWS_FT_FI2 26) chain A residue 241 type BINDING sequence D description BINDING => ECO:0000255|HAMAP-Rule:MF_01836, ECO:0000269|PubMed:15304218, ECO:0000269|PubMed:16628225, ECO:0000269|PubMed:22304631, ECO:0007744|PDB:1TF7, ECO:0007744|PDB:2GBL, ECO:0007744|PDB:4DUG source Swiss-Prot : SWS_FT_FI2 27) chain A residue 50 type BINDING sequence T description BINDING => ECO:0000255|HAMAP-Rule:MF_01836, ECO:0000269|PubMed:15304218, ECO:0000269|PubMed:16628225, ECO:0000269|PubMed:22304631, ECO:0007744|PDB:1TF7, ECO:0007744|PDB:2GBL, ECO:0007744|PDB:4DUG source Swiss-Prot : SWS_FT_FI2 28) chain A residue 51 type BINDING sequence G description BINDING => ECO:0000255|HAMAP-Rule:MF_01836, ECO:0000269|PubMed:15304218, ECO:0000269|PubMed:16628225, ECO:0000269|PubMed:22304631, ECO:0007744|PDB:1TF7, ECO:0007744|PDB:2GBL, ECO:0007744|PDB:4DUG source Swiss-Prot : SWS_FT_FI2 29) chain A residue 52 type BINDING sequence K description BINDING => ECO:0000255|HAMAP-Rule:MF_01836, ECO:0000269|PubMed:15304218, ECO:0000269|PubMed:16628225, ECO:0000269|PubMed:22304631, ECO:0007744|PDB:1TF7, ECO:0007744|PDB:2GBL, ECO:0007744|PDB:4DUG source Swiss-Prot : SWS_FT_FI2 30) chain A residue 54 type BINDING sequence L description BINDING => ECO:0000255|HAMAP-Rule:MF_01836, ECO:0000269|PubMed:15304218, ECO:0000269|PubMed:16628225, ECO:0000269|PubMed:22304631, ECO:0007744|PDB:1TF7, ECO:0007744|PDB:2GBL, ECO:0007744|PDB:4DUG source Swiss-Prot : SWS_FT_FI2 31) chain A residue 89 type BINDING sequence S description BINDING => ECO:0000255|HAMAP-Rule:MF_01836, ECO:0000269|PubMed:15304218, ECO:0000269|PubMed:16628225, ECO:0000269|PubMed:22304631, ECO:0007744|PDB:1TF7, ECO:0007744|PDB:2GBL, ECO:0007744|PDB:4DUG source Swiss-Prot : SWS_FT_FI2 32) chain A residue 224 type BINDING sequence K description BINDING => ECO:0000255|HAMAP-Rule:MF_01836, ECO:0000269|PubMed:15304218, ECO:0000269|PubMed:16628225, ECO:0000269|PubMed:22304631, ECO:0007744|PDB:1TF7, ECO:0007744|PDB:2GBL, ECO:0007744|PDB:4DUG source Swiss-Prot : SWS_FT_FI2 33) chain A residue 226 type BINDING sequence R description BINDING => ECO:0000255|HAMAP-Rule:MF_01836, ECO:0000269|PubMed:15304218, ECO:0000269|PubMed:16628225, ECO:0000269|PubMed:22304631, ECO:0007744|PDB:1TF7, ECO:0007744|PDB:2GBL, ECO:0007744|PDB:4DUG source Swiss-Prot : SWS_FT_FI2 34) chain A residue 228 type BINDING sequence T description BINDING => ECO:0000255|HAMAP-Rule:MF_01836, ECO:0000269|PubMed:15304218, ECO:0000269|PubMed:16628225, ECO:0000269|PubMed:22304631, ECO:0007744|PDB:1TF7, ECO:0007744|PDB:2GBL, ECO:0007744|PDB:4DUG source Swiss-Prot : SWS_FT_FI2 35) chain A residue 53 type BINDING sequence T description BINDING => ECO:0000255|HAMAP-Rule:MF_01836, ECO:0007744|PDB:4DUG, ECO:0007744|PDB:4TL6, ECO:0007744|PDB:7DXQ source Swiss-Prot : SWS_FT_FI3 36) chain A residue 225 type BINDING sequence L description BINDING => ECO:0000255|HAMAP-Rule:MF_01836, ECO:0000269|PubMed:15304218, ECO:0000269|PubMed:16628225, ECO:0007744|PDB:1TF7, ECO:0007744|PDB:2GBL source Swiss-Prot : SWS_FT_FI4 37) chain A residue 77 type ACT_SITE sequence E description Proton acceptor in CI (KaiC 1) => ECO:0000305|PubMed:22304631 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links