eF-site ID 4tky-C PDB Code 4tky Chain C click to enlarge Title The complex structure of E. coli DsbA bound to a peptide at the DsbA/DsbB interface Classification OXIDOREDUCTASE/PEPTIDE INHIBITOR Compound Thiol:disulfide interchange protein DsbA Source (4TKY) Sequence C:  AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHAYQFEEVL HISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAM ALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGE EYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQ LNPQGMDTSNMDVFVQQYADTVKYLSEK Description Functional site 1) chain C residue 62 type sequence N description binding site for Di-peptide NH2 E 202 and SER E 106 source : AC2 2) chain C residue 139 type sequence E description binding site for Di-peptide NH2 E 202 and SER E 106 source : AC2 3) chain C residue 34 type sequence Y description binding site for Di-peptide ACE F 201 and PRO F 100 source : AC3 4) chain C residue 35 type sequence Q description binding site for Di-peptide ACE F 201 and PRO F 100 source : AC3 5) chain C residue 40 type sequence L description binding site for Di-peptide ACE H 201 and PRO H 100 source : AC7 6) chain C residue 171 type sequence M description binding site for Di-peptide ACE H 201 and PRO H 100 source : AC7 7) chain C residue 63 type sequence F description binding site for Di-peptide NH2 H 202 and SER H 106 source : AC8 8) chain C residue 148 type sequence R description binding site for Di-peptide NH2 H 202 and SER H 106 source : AC8

Display surface Download Links