eF-site ID 4rxn-A PDB Code 4rxn Chain A click to enlarge Title CRYSTALLOGRAPHIC REFINEMENT OF RUBREDOXIN AT 1.2 ANGSTROMS RESOLUTION Classification ELECTRON TRANSFER(IRON-SULFUR PROTEIN) Compound RUBREDOXIN Source Clostridium pasteurianum (RUBR_CLOPA) Sequence A:  MKKYTCTVCGYIYDPEDGDPDDGVNPGTDFKDIPDDWVCP LCGVGKDEFEEVEE Description Functional site 1) chain A residue 6 type sequence C description BINDING SITE FOR RESIDUE FE A 55 source : AC1 2) chain A residue 9 type sequence C description BINDING SITE FOR RESIDUE FE A 55 source : AC1 3) chain A residue 39 type sequence C description BINDING SITE FOR RESIDUE FE A 55 source : AC1 4) chain A residue 42 type sequence C description BINDING SITE FOR RESIDUE FE A 55 source : AC1 5) chain A residue 1 type MOD_RES sequence M description N-formylmethionine => ECO:0000269|PubMed:1637309 source Swiss-Prot : SWS_FT_FI2 6) chain A residue 33-43 type prosite sequence IPDDWVCPLCG description RUBREDOXIN Rubredoxin signature. IpDDWvCPlCG source prosite : PS00202 7) chain A residue 6 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00241, ECO:0000269|PubMed:10216292 source Swiss-Prot : SWS_FT_FI1 8) chain A residue 9 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00241, ECO:0000269|PubMed:10216292 source Swiss-Prot : SWS_FT_FI1 9) chain A residue 39 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00241, ECO:0000269|PubMed:10216292 source Swiss-Prot : SWS_FT_FI1 10) chain A residue 42 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00241, ECO:0000269|PubMed:10216292 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links