eF-site ID 4rx3-A PDB Code 4rx3 Chain A click to enlarge Title A triple mutant in the omega-loop of TEM-1 beta-lactamase changes the substrate profile via a large conformational change and an altered general base for catalysis Classification HYDROLASE Compound Beta-lactamase TEM Source Escherichia coli (BLAT_ECOLX) Sequence A:  HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEER FPMMGTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEY SPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGP KELTAFLHNMGDHVTRLDRYYGELNEAIPNDERDTTMPAA MATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSAL PAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTG SQATMDERNRQIAEIGASLIKHW Description (1)  Beta-lactamase TEM (E.C.3.5.2.6) Functional site 1) chain A residue 28 type sequence E description BINDING SITE FOR RESIDUE FLC A 301 source : AC1 2) chain A residue 69 type sequence M description BINDING SITE FOR RESIDUE FLC A 301 source : AC1 3) chain A residue 70 type sequence G description BINDING SITE FOR RESIDUE FLC A 301 source : AC1 4) chain A residue 73 type sequence K description BINDING SITE FOR RESIDUE FLC A 301 source : AC1 5) chain A residue 105 type sequence Y description BINDING SITE FOR RESIDUE FLC A 301 source : AC1 6) chain A residue 130 type sequence S description BINDING SITE FOR RESIDUE FLC A 301 source : AC1 7) chain A residue 132 type sequence N description BINDING SITE FOR RESIDUE FLC A 301 source : AC1 8) chain A residue 166 type sequence Y description BINDING SITE FOR RESIDUE FLC A 301 source : AC1 9) chain A residue 236 type sequence G description BINDING SITE FOR RESIDUE FLC A 301 source : AC1 10) chain A residue 237 type sequence A description BINDING SITE FOR RESIDUE FLC A 301 source : AC1 11) chain A residue 288 type sequence K description BINDING SITE FOR RESIDUE FLC A 301 source : AC1 12) chain A residue 289 type sequence H description BINDING SITE FOR RESIDUE FLC A 301 source : AC1 13) chain A residue 70 type catalytic sequence G description 2 source MCSA : MCSA1 14) chain A residue 73 type catalytic sequence K description 2 source MCSA : MCSA1 15) chain A residue 130 type catalytic sequence S description 2 source MCSA : MCSA1 16) chain A residue 166 type catalytic sequence Y description 2 source MCSA : MCSA1 17) chain A residue 234 type catalytic sequence K description 2 source MCSA : MCSA1 18) chain A residue 237 type catalytic sequence A description 2 source MCSA : MCSA1 19) chain A residue 234 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI3 20) chain A residue 70 type ACT_SITE sequence G description Acyl-ester intermediate source Swiss-Prot : SWS_FT_FI1 21) chain A residue 168 type ACT_SITE sequence E description Proton acceptor source Swiss-Prot : SWS_FT_FI2

Display surface Download Links