eF-site ID 4rwo-ABC PDB Code 4rwo Chain A, B, C click to enlarge Title Crystal structure of the porcine OAS1 L149R mutant in complex with dsRNA and ApCpp in the AMP donor position Classification TRANSFERASE/RNA Compound RNA (5'-R(*GP*GP*CP*UP*UP*UP*UP*GP*AP*CP*CP*UP*UP*UP*AP*UP*GP*AP*A)-3') Source Sus scrofa (Pig) (4RWO) Sequence A:  MELRHTPARDLDKFIEDHLLPNTCFRTQVKEAIDIVCRFL KERCFQGTADPVRVSKVVKGGSSGKGTTLRGRSDADLVVF LTKLTSFEDQLRRRGEFIQEIRRQLEACQREQKFKVTFEV QSPRRENPRALSFVLSSPQLQQEVEFDVRPAFDALGQWTP GYKPNPEIYVQLIKECKSRGKEGEFSTCFTELQRDFLRNR PTKLKSLIRLVKHWYQTCKKTHGNKLPPQYALELLTVYAW EQGSRKTDFSTAQGFQTVLELVLKHQKLCIFWEAYYDFTN PVVGRCMLQQLKKPRPVILDPADPTGNVGGGDTHSWQRLA QEARVWLGYPCCKNLDGSLVGAWTMLQ B:  GGCUUUUGACCUUUAUGAA C:  UUCAUAAAGGUCAAAAGCC Description Functional site 1) chain A residue 74 type sequence D description BINDING SITE FOR RESIDUE MG A 401 source : AC1 2) chain A residue 76 type sequence D description BINDING SITE FOR RESIDUE MG A 401 source : AC1 3) chain A residue 74 type sequence D description BINDING SITE FOR RESIDUE MG A 402 source : AC2 4) chain A residue 76 type sequence D description BINDING SITE FOR RESIDUE MG A 402 source : AC2 5) chain A residue 147 type sequence D description BINDING SITE FOR RESIDUE MG A 402 source : AC2 6) chain A residue 61 type sequence G description BINDING SITE FOR RESIDUE APC A 403 source : AC3 7) chain A residue 62 type sequence S description BINDING SITE FOR RESIDUE APC A 403 source : AC3 8) chain A residue 65 type sequence K description BINDING SITE FOR RESIDUE APC A 403 source : AC3 9) chain A residue 73 type sequence S description BINDING SITE FOR RESIDUE APC A 403 source : AC3 10) chain A residue 74 type sequence D description BINDING SITE FOR RESIDUE APC A 403 source : AC3 11) chain A residue 76 type sequence D description BINDING SITE FOR RESIDUE APC A 403 source : AC3 12) chain A residue 186 type sequence S description BINDING SITE FOR RESIDUE APC A 403 source : AC3 13) chain A residue 193 type sequence Q description BINDING SITE FOR RESIDUE APC A 403 source : AC3 14) chain A residue 212 type sequence K description BINDING SITE FOR RESIDUE APC A 403 source : AC3 15) chain A residue 229 type sequence Q description BINDING SITE FOR RESIDUE APC A 403 source : AC3 16) chain A residue 230 type sequence Y description BINDING SITE FOR RESIDUE APC A 403 source : AC3 17) chain A residue 157 type SITE sequence Q description Interaction with dsRNA => ECO:0000250|UniProtKB:P00973 source Swiss-Prot : SWS_FT_FI4 18) chain A residue 62 type BINDING sequence S description BINDING => ECO:0000250|UniProtKB:P00973 source Swiss-Prot : SWS_FT_FI1 19) chain A residue 74 type BINDING sequence D description BINDING => ECO:0000250|UniProtKB:P00973 source Swiss-Prot : SWS_FT_FI1 20) chain A residue 76 type BINDING sequence D description BINDING => ECO:0000250|UniProtKB:P00973 source Swiss-Prot : SWS_FT_FI1 21) chain A residue 147 type BINDING sequence D description BINDING => ECO:0000250|UniProtKB:P00973 source Swiss-Prot : SWS_FT_FI1 22) chain A residue 229 type BINDING sequence Q description BINDING => ECO:0000250|UniProtKB:P00973 source Swiss-Prot : SWS_FT_FI1 23) chain A residue 209 type BINDING sequence R description BINDING => ECO:0000305|PubMed:18604630 source Swiss-Prot : SWS_FT_FI2 24) chain A residue 212 type BINDING sequence K description BINDING => ECO:0000305|PubMed:14636576 source Swiss-Prot : SWS_FT_FI3 25) chain A residue 61-80 type prosite sequence GSSGKGTTLRGRSDADLVVF description 25A_SYNTH_1 2'-5'-oligoadenylate synthases signature 1. GSsGKgTtLRgrsDaDLVvF source prosite : PS00832 26) chain A residue 295-305 type prosite sequence RPVILDPADPT description 25A_SYNTH_2 2'-5'-oligoadenylate synthases signature 2. RPVILDPaDPT source prosite : PS00833

Display surface Download Links