eF-site ID 4rvy-V PDB Code 4rvy Chain V click to enlarge Title Serial Time resolved crystallography of Photosystem II using a femtosecond X-ray laser. The S state after two flashes (S3) Classification OXIDOREDUCTASE Compound Photosystem II protein D1 1 Source ORGANISM_SCIENTIFIC: Thermosynechococcus elongatus; Sequence V:  AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASC HVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPT TYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHIL VEPKILGDKWGGGKVYY Description Functional site 1) chain V residue 36 type sequence A description BINDING SITE FOR RESIDUE HEM V 201 source : RC8 2) chain V residue 37 type sequence C description BINDING SITE FOR RESIDUE HEM V 201 source : RC8 3) chain V residue 40 type sequence C description BINDING SITE FOR RESIDUE HEM V 201 source : RC8 4) chain V residue 41 type sequence H description BINDING SITE FOR RESIDUE HEM V 201 source : RC8 5) chain V residue 46 type sequence T description BINDING SITE FOR RESIDUE HEM V 201 source : RC8 6) chain V residue 48 type sequence T description BINDING SITE FOR RESIDUE HEM V 201 source : RC8 7) chain V residue 52 type sequence L description BINDING SITE FOR RESIDUE HEM V 201 source : RC8 8) chain V residue 53 type sequence D description BINDING SITE FOR RESIDUE HEM V 201 source : RC8 9) chain V residue 54 type sequence L description BINDING SITE FOR RESIDUE HEM V 201 source : RC8 10) chain V residue 58 type sequence T description BINDING SITE FOR RESIDUE HEM V 201 source : RC8 11) chain V residue 59 type sequence L description BINDING SITE FOR RESIDUE HEM V 201 source : RC8 12) chain V residue 62 type sequence A description BINDING SITE FOR RESIDUE HEM V 201 source : RC8 13) chain V residue 72 type sequence L description BINDING SITE FOR RESIDUE HEM V 201 source : RC8 14) chain V residue 75 type sequence Y description BINDING SITE FOR RESIDUE HEM V 201 source : RC8 15) chain V residue 76 type sequence M description BINDING SITE FOR RESIDUE HEM V 201 source : RC8 16) chain V residue 82 type sequence Y description BINDING SITE FOR RESIDUE HEM V 201 source : RC8 17) chain V residue 88 type sequence I description BINDING SITE FOR RESIDUE HEM V 201 source : RC8 18) chain V residue 92 type sequence H description BINDING SITE FOR RESIDUE HEM V 201 source : RC8 19) chain V residue 93 type sequence P description BINDING SITE FOR RESIDUE HEM V 201 source : RC8 20) chain V residue 115 type sequence I description BINDING SITE FOR RESIDUE HEM V 201 source : RC8

Display surface Download Links