eF-site ID 4rvy-T PDB Code 4rvy Chain T click to enlarge Title Serial Time resolved crystallography of Photosystem II using a femtosecond X-ray laser. The S state after two flashes (S3) Classification OXIDOREDUCTASE Compound Photosystem II protein D1 1 Source ORGANISM_SCIENTIFIC: Thermosynechococcus elongatus; Sequence T:  METITYVFIFACIIALFFFAIFFREPPRIT Description Functional site 1) chain T residue 17 type sequence F description BINDING SITE FOR RESIDUE CLA A 603 source : AC3 2) chain T residue 22 type sequence F description BINDING SITE FOR RESIDUE SQD b 601 source : FC6 3) chain T residue 8 type sequence F description BINDING SITE FOR RESIDUE CLA b 615 source : HC2 4) chain T residue 12 type sequence C description BINDING SITE FOR RESIDUE SQD b 621 source : HC8 5) chain T residue 19 type sequence F description BINDING SITE FOR RESIDUE SQD b 621 source : HC8 6) chain T residue 23 type sequence F description BINDING SITE FOR RESIDUE SQD b 621 source : HC8 7) chain T residue 18 type sequence F description BINDING SITE FOR RESIDUE BCR b 622 source : HC9 8) chain T residue 17 type sequence F description BINDING SITE FOR RESIDUE LHG D 407 source : NC2 9) chain T residue 20 type sequence A description BINDING SITE FOR RESIDUE LHG D 407 source : NC2 10) chain T residue 10 type sequence F description BINDING SITE FOR RESIDUE PL9 D 408 source : NC3 11) chain T residue 16 type sequence L description BINDING SITE FOR RESIDUE SQD L 101 source : QC7 12) chain T residue 19 type sequence F description BINDING SITE FOR RESIDUE SQD L 101 source : QC7 13) chain T residue 23 type sequence F description BINDING SITE FOR RESIDUE SQD L 101 source : QC7 14) chain T residue 19 type sequence F description BINDING SITE FOR RESIDUE BCR T 101 source : RC5 15) chain T residue 22 type sequence F description BINDING SITE FOR RESIDUE BCR T 102 source : RC6

Display surface Download Links