eF-site ID 4rvy-I PDB Code 4rvy Chain I click to enlarge Title Serial Time resolved crystallography of Photosystem II using a femtosecond X-ray laser. The S state after two flashes (S3) Classification OXIDOREDUCTASE Compound Photosystem II protein D1 1 Source ORGANISM_SCIENTIFIC: Thermosynechococcus elongatus; Sequence I:  METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRKDLE Description Functional site 1) chain I residue 8 type sequence V description BINDING SITE FOR RESIDUE CLA A 607 source : AC7 2) chain I residue 9 type sequence Y description BINDING SITE FOR RESIDUE CLA A 607 source : AC7 3) chain I residue 12 type sequence V description BINDING SITE FOR RESIDUE CLA A 607 source : AC7 4) chain I residue 15 type sequence F description BINDING SITE FOR RESIDUE CLA A 607 source : AC7 5) chain I residue 5 type sequence K description BINDING SITE FOR RESIDUE LMG A 614 source : BC5 6) chain I residue 9 type sequence Y description BINDING SITE FOR RESIDUE LMG A 614 source : BC5 7) chain I residue 23 type sequence F description BINDING SITE FOR RESIDUE BCR C 515 source : JC6

Display surface Download Links