eF-site ID 4rvy-i PDB Code 4rvy Chain i click to enlarge Title Serial Time resolved crystallography of Photosystem II using a femtosecond X-ray laser. The S state after two flashes (S3) Classification OXIDOREDUCTASE Compound Photosystem II protein D1 1 Source ORGANISM_SCIENTIFIC: Thermosynechococcus elongatus; Sequence i:  METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRKDLE Description Functional site 1) chain i residue 8 type sequence V description BINDING SITE FOR RESIDUE CLA a 607 source : CC3 2) chain i residue 9 type sequence Y description BINDING SITE FOR RESIDUE CLA a 607 source : CC3 3) chain i residue 12 type sequence V description BINDING SITE FOR RESIDUE CLA a 607 source : CC3 4) chain i residue 15 type sequence F description BINDING SITE FOR RESIDUE CLA a 607 source : CC3 5) chain i residue 5 type sequence K description BINDING SITE FOR RESIDUE LMG a 614 source : DC1 6) chain i residue 9 type sequence Y description BINDING SITE FOR RESIDUE LMG a 614 source : DC1 7) chain i residue 23 type sequence F description BINDING SITE FOR RESIDUE BCR c 515 source : LC8

Display surface Download Links