eF-site ID 4rvy-f PDB Code 4rvy Chain f click to enlarge Title Serial Time resolved crystallography of Photosystem II using a femtosecond X-ray laser. The S state after two flashes (S3) Classification OXIDOREDUCTASE Compound Photosystem II protein D1 1 Source ORGANISM_SCIENTIFIC: Thermosynechococcus elongatus; Sequence f:  SYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR Description Functional site 1) chain f residue 25 type sequence T description BINDING SITE FOR RESIDUE PL9 a 613 source : CC9 2) chain f residue 26 type sequence L description BINDING SITE FOR RESIDUE PL9 a 613 source : CC9 3) chain f residue 29 type sequence P description BINDING SITE FOR RESIDUE BCR d 404 source : OC1 4) chain f residue 30 type sequence T description BINDING SITE FOR RESIDUE BCR d 404 source : OC1 5) chain f residue 30 type sequence T description BINDING SITE FOR RESIDUE LMG d 406 source : OC3 6) chain f residue 37 type sequence I description BINDING SITE FOR RESIDUE LMG d 406 source : OC3 7) chain f residue 40 type sequence M description BINDING SITE FOR RESIDUE LMG d 406 source : OC3 8) chain f residue 41 type sequence Q description BINDING SITE FOR RESIDUE LMG d 406 source : OC3 9) chain f residue 16 type sequence F description BINDING SITE FOR RESIDUE SQD d 411 source : OC8 10) chain f residue 17 type sequence T description BINDING SITE FOR RESIDUE SQD d 411 source : OC8 11) chain f residue 18 type sequence V description BINDING SITE FOR RESIDUE SQD d 411 source : OC8 12) chain f residue 19 type sequence R description BINDING SITE FOR RESIDUE HEM f 101 source : PC4 13) chain f residue 20 type sequence W description BINDING SITE FOR RESIDUE HEM f 101 source : PC4 14) chain f residue 23 type sequence V description BINDING SITE FOR RESIDUE HEM f 101 source : PC4 15) chain f residue 24 type sequence H description BINDING SITE FOR RESIDUE HEM f 101 source : PC4 16) chain f residue 27 type sequence A description BINDING SITE FOR RESIDUE HEM f 101 source : PC4 17) chain f residue 31 type sequence I description BINDING SITE FOR RESIDUE HEM f 101 source : PC4 18) chain f residue 45 type sequence R description BINDING SITE FOR RESIDUE CA f 102 source : PC5

Display surface Download Links