eF-site ID 4rup-A PDB Code 4rup Chain A click to enlarge Title Crystal structure of zVDR L337H mutant-Gemini72 complex Classification Transcription Factor Compound Vitamin D3 receptor A Source (NCOA1_HUMAN) Sequence A:  HMLSDEQMQIINSLVEAHHKTYDDSYSDFVRFRPPVRRLS MLPHLADLVSYSIQKVIGFAKMIPGFRDLTAEDQIALLKS SAIEIIMLRSNQSFSLEDMSWSCGGPDFKYCINDVTKAGH TLEHLEPLVKFQVGLKKLKLHEEEHVLLMAICLLSPDRPG VQDHVRIEALQDRLCDVLQAYIRIQHPGGRLLYAKMIQKL ADLRSLNEEHSKQYRSLSFQPEHSMQLTPLVLEVFGSEV Description Functional site 1) chain A residue 175 type sequence Y description BINDING SITE FOR RESIDUE H97 A 501 source : AC1 2) chain A residue 255 type sequence L description BINDING SITE FOR RESIDUE H97 A 501 source : AC1 3) chain A residue 262 type sequence V description BINDING SITE FOR RESIDUE H97 A 501 source : AC1 4) chain A residue 265 type sequence S description BINDING SITE FOR RESIDUE H97 A 501 source : AC1 5) chain A residue 300 type sequence M description BINDING SITE FOR RESIDUE H97 A 501 source : AC1 6) chain A residue 302 type sequence R description BINDING SITE FOR RESIDUE H97 A 501 source : AC1 7) chain A residue 303 type sequence S description BINDING SITE FOR RESIDUE H97 A 501 source : AC1 8) chain A residue 306 type sequence S description BINDING SITE FOR RESIDUE H97 A 501 source : AC1 9) chain A residue 314 type sequence W description BINDING SITE FOR RESIDUE H97 A 501 source : AC1 10) chain A residue 316 type sequence C description BINDING SITE FOR RESIDUE H97 A 501 source : AC1 11) chain A residue 328 type sequence V description BINDING SITE FOR RESIDUE H97 A 501 source : AC1 12) chain A residue 331 type sequence A description BINDING SITE FOR RESIDUE H97 A 501 source : AC1 13) chain A residue 333 type sequence H description BINDING SITE FOR RESIDUE H97 A 501 source : AC1 14) chain A residue 337 type sequence H description BINDING SITE FOR RESIDUE H97 A 501 source : AC1 15) chain A residue 338 type sequence L description BINDING SITE FOR RESIDUE H97 A 501 source : AC1 16) chain A residue 423 type sequence H description BINDING SITE FOR RESIDUE H97 A 501 source : AC1 17) chain A residue 427 type sequence Y description BINDING SITE FOR RESIDUE H97 A 501 source : AC1 18) chain A residue 430 type sequence L description BINDING SITE FOR RESIDUE H97 A 501 source : AC1 19) chain A residue 440 type sequence L description BINDING SITE FOR RESIDUE H97 A 501 source : AC1 20) chain A residue 444 type sequence V description BINDING SITE FOR RESIDUE H97 A 501 source : AC1 21) chain A residue 448 type sequence F description BINDING SITE FOR RESIDUE H97 A 501 source : AC1 22) chain A residue 333 type MOD_RES sequence H description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI1 23) chain A residue 423 type MOD_RES sequence H description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI1 24) chain A residue 255 type MOD_RES sequence L description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI1 25) chain A residue 299 type MOD_RES sequence I description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links