eF-site ID 4rua-APT PDB Code 4rua Chain A, P, T click to enlarge Title Crystal structure of Y-family DNA polymerase Dpo4 bypassing a MeFapy-dG adduct Classification TRANSFERASE/DNA Compound DNA polymerase IV Source Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (4RUA) Sequence A:  MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDS GAVATANYEARKFGVKAGIPIVEAKKILPNAVYLPMRKEV YQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYRE AYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAADMAKP NGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGIN KLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTR VRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRI PKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQ KILEEDERKIRRIGVRFSKFI P:  GGGGGAAGGATTC T:  CATXGAATCCTTCCCCC Description Functional site 1) chain A residue 7 type sequence D description BINDING SITE FOR RESIDUE DTP A 401 source : AC1 2) chain A residue 8 type sequence F description BINDING SITE FOR RESIDUE DTP A 401 source : AC1 3) chain A residue 10 type sequence Y description BINDING SITE FOR RESIDUE DTP A 401 source : AC1 4) chain A residue 11 type sequence F description BINDING SITE FOR RESIDUE DTP A 401 source : AC1 5) chain A residue 12 type sequence Y description BINDING SITE FOR RESIDUE DTP A 401 source : AC1 6) chain A residue 44 type sequence A description BINDING SITE FOR RESIDUE DTP A 401 source : AC1 7) chain A residue 45 type sequence T description BINDING SITE FOR RESIDUE DTP A 401 source : AC1 8) chain A residue 48 type sequence Y description BINDING SITE FOR RESIDUE DTP A 401 source : AC1 9) chain A residue 51 type sequence R description BINDING SITE FOR RESIDUE DTP A 401 source : AC1 10) chain A residue 105 type sequence D description BINDING SITE FOR RESIDUE DTP A 401 source : AC1 11) chain A residue 106 type sequence E description BINDING SITE FOR RESIDUE DTP A 401 source : AC1 12) chain A residue 159 type sequence K description BINDING SITE FOR RESIDUE DTP A 401 source : AC1 13) chain T residue 404 type sequence T description BINDING SITE FOR RESIDUE DTP A 401 source : AC1 14) chain T residue 405 type sequence X description BINDING SITE FOR RESIDUE DTP A 401 source : AC1 15) chain A residue 181 type sequence A description BINDING SITE FOR RESIDUE CA A 402 source : AC2 16) chain A residue 186 type sequence I description BINDING SITE FOR RESIDUE CA A 402 source : AC2 17) chain A residue 7 type sequence D description BINDING SITE FOR RESIDUE CA A 403 source : AC3 18) chain A residue 8 type sequence F description BINDING SITE FOR RESIDUE CA A 403 source : AC3 19) chain A residue 105 type sequence D description BINDING SITE FOR RESIDUE CA A 403 source : AC3 20) chain A residue 105 type sequence D description BINDING SITE FOR RESIDUE CA A 404 source : AC4 21) chain A residue 106 type sequence E description BINDING SITE FOR RESIDUE CA A 404 source : AC4 22) chain P residue 513 type sequence C description BINDING SITE FOR RESIDUE CA A 404 source : AC4 23) chain A residue 106 type ACT_SITE sequence E description source Swiss-Prot : SWS_FT_FI1 24) chain A residue 7 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 25) chain A residue 105 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 26) chain A residue 12 type SITE sequence Y description Substrate discrimination source Swiss-Prot : SWS_FT_FI3

Display surface Download Links