eF-site ID 4rrr-B PDB Code 4rrr Chain B click to enlarge Title K121M mutant of N-terminal editing domain of threonyl-tRNA synthetase from Pyrococcus abyssi with L-Thr3AA Classification LIGASE Compound Threonine--tRNA ligase Source Pyrococcus abyssi (strain GE5 / Orsay) (SYT_PYRAB) Sequence B:  MRVLLIHSDYIEYEVKDKALKNPEPISEDMKRGRMEEVLV AFISVEKVDEKNPEEVSLKAIEEISKVAEQVKAENVFVYP FAHLSSELAKPSVAMDILNRVYQGLKERGFNVGKAPFGYY MAFKISCKGHPLAELSRTIVPE Description Functional site 1) chain B residue 134 type sequence E description BINDING SITE FOR RESIDUE A3T A 201 source : AC1 2) chain B residue 19 type sequence A description BINDING SITE FOR RESIDUE A3T B 201 source : AC2 3) chain B residue 20 type sequence L description BINDING SITE FOR RESIDUE A3T B 201 source : AC2 4) chain B residue 43 type sequence I description BINDING SITE FOR RESIDUE A3T B 201 source : AC2 5) chain B residue 45 type sequence V description BINDING SITE FOR RESIDUE A3T B 201 source : AC2 6) chain B residue 80 type sequence P description BINDING SITE FOR RESIDUE A3T B 201 source : AC2 7) chain B residue 81 type sequence F description BINDING SITE FOR RESIDUE A3T B 201 source : AC2 8) chain B residue 82 type sequence A description BINDING SITE FOR RESIDUE A3T B 201 source : AC2 9) chain B residue 94 type sequence A description BINDING SITE FOR RESIDUE A3T B 201 source : AC2 10) chain B residue 117 type sequence F description BINDING SITE FOR RESIDUE A3T B 201 source : AC2 11) chain B residue 118 type sequence G description BINDING SITE FOR RESIDUE A3T B 201 source : AC2 12) chain B residue 119 type sequence Y description BINDING SITE FOR RESIDUE A3T B 201 source : AC2 13) chain B residue 120 type sequence Y description BINDING SITE FOR RESIDUE A3T B 201 source : AC2 14) chain B residue 121 type sequence M description BINDING SITE FOR RESIDUE A3T B 201 source : AC2

Display surface Download Links