eF-site ID 4rrr-AB
PDB Code 4rrr
Chain A, B

click to enlarge
Title K121M mutant of N-terminal editing domain of threonyl-tRNA synthetase from Pyrococcus abyssi with L-Thr3AA
Classification LIGASE
Compound Threonine--tRNA ligase
Source Pyrococcus abyssi (strain GE5 / Orsay) (SYT_PYRAB)
Sequence A:  MRVLLIHSDYIEYEVKDKALKNPEPISEDMKRGRMEEVLV
AFISVEKVDEKNPEEVSLKAIEEISKVAEQVKAENVFVYP
FAHLSSELAKPSVAMDILNRVYQGLKERGFNVGKAPFGYY
MAFKISCKGHPLAELSRTIVPEE
B:  MRVLLIHSDYIEYEVKDKALKNPEPISEDMKRGRMEEVLV
AFISVEKVDEKNPEEVSLKAIEEISKVAEQVKAENVFVYP
FAHLSSELAKPSVAMDILNRVYQGLKERGFNVGKAPFGYY
MAFKISCKGHPLAELSRTIVPE
Description (1)  Threonine--tRNA ligase (E.C.6.1.1.3)


Functional site

1) chain A
residue 19
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A3T A 201
source : AC1

2) chain A
residue 43
type
ligand
sequence I
description BINDING SITE FOR RESIDUE A3T A 201
source : AC1

3) chain A
residue 45
type
ligand
sequence V
description BINDING SITE FOR RESIDUE A3T A 201
source : AC1

4) chain A
residue 80
type
ligand
sequence P
description BINDING SITE FOR RESIDUE A3T A 201
source : AC1

5) chain A
residue 81
type
ligand
sequence F
description BINDING SITE FOR RESIDUE A3T A 201
source : AC1

6) chain A
residue 82
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A3T A 201
source : AC1

7) chain A
residue 89
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A3T A 201
source : AC1

8) chain A
residue 94
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A3T A 201
source : AC1

9) chain A
residue 117
type
ligand
sequence F
description BINDING SITE FOR RESIDUE A3T A 201
source : AC1

10) chain A
residue 118
type
ligand
sequence G
description BINDING SITE FOR RESIDUE A3T A 201
source : AC1

11) chain A
residue 119
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE A3T A 201
source : AC1

12) chain A
residue 120
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE A3T A 201
source : AC1

13) chain A
residue 121
type
ligand
sequence M
description BINDING SITE FOR RESIDUE A3T A 201
source : AC1

14) chain B
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE A3T A 201
source : AC1

15) chain A
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE A3T B 201
source : AC2

16) chain B
residue 19
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A3T B 201
source : AC2

17) chain B
residue 20
type
ligand
sequence L
description BINDING SITE FOR RESIDUE A3T B 201
source : AC2

18) chain B
residue 43
type
ligand
sequence I
description BINDING SITE FOR RESIDUE A3T B 201
source : AC2

19) chain B
residue 45
type
ligand
sequence V
description BINDING SITE FOR RESIDUE A3T B 201
source : AC2

20) chain B
residue 80
type
ligand
sequence P
description BINDING SITE FOR RESIDUE A3T B 201
source : AC2

21) chain B
residue 81
type
ligand
sequence F
description BINDING SITE FOR RESIDUE A3T B 201
source : AC2

22) chain B
residue 82
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A3T B 201
source : AC2

23) chain B
residue 94
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A3T B 201
source : AC2

24) chain B
residue 117
type
ligand
sequence F
description BINDING SITE FOR RESIDUE A3T B 201
source : AC2

25) chain B
residue 118
type
ligand
sequence G
description BINDING SITE FOR RESIDUE A3T B 201
source : AC2

26) chain B
residue 119
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE A3T B 201
source : AC2

27) chain B
residue 120
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE A3T B 201
source : AC2

28) chain B
residue 121
type
ligand
sequence M
description BINDING SITE FOR RESIDUE A3T B 201
source : AC2

29) chain A
residue 19-20
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence AL
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrr_A_201

30) chain A
residue 43-45
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence ISV
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrr_A_201

31) chain A
residue 79-83
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence YPFAH
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrr_A_201

32) chain A
residue 88-89
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence LA
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrr_A_201

33) chain A
residue 91
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence P
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrr_A_201

34) chain A
residue 94
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence A
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrr_A_201

35) chain A
residue 98
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence L
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrr_A_201

36) chain A
residue 116-121
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence PFGYYM
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrr_A_201

37) chain B
residue 129
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence G
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrr_A_201

38) chain B
residue 134
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence E
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrr_A_201

39) chain A
residue 129
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence G
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrr_B_201

40) chain A
residue 134
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence E
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrr_B_201

41) chain B
residue 19-20
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence AL
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrr_B_201

42) chain B
residue 43-45
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence ISV
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrr_B_201

43) chain B
residue 79-83
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence YPFAH
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrr_B_201

44) chain B
residue 88-89
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence LA
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrr_B_201

45) chain B
residue 91
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence P
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrr_B_201

46) chain B
residue 94
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence A
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrr_B_201

47) chain B
residue 98
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence L
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrr_B_201

48) chain B
residue 116-121
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence PFGYYM
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrr_B_201


Display surface

Download
Links