eF-site ID 4rrr-A PDB Code 4rrr Chain A click to enlarge Title K121M mutant of N-terminal editing domain of threonyl-tRNA synthetase from Pyrococcus abyssi with L-Thr3AA Classification LIGASE Compound Threonine--tRNA ligase Source Pyrococcus abyssi (strain GE5 / Orsay) (SYT_PYRAB) Sequence A:  MRVLLIHSDYIEYEVKDKALKNPEPISEDMKRGRMEEVLV AFISVEKVDEKNPEEVSLKAIEEISKVAEQVKAENVFVYP FAHLSSELAKPSVAMDILNRVYQGLKERGFNVGKAPFGYY MAFKISCKGHPLAELSRTIVPEE Description Functional site 1) chain A residue 19 type sequence A description BINDING SITE FOR RESIDUE A3T A 201 source : AC1 2) chain A residue 43 type sequence I description BINDING SITE FOR RESIDUE A3T A 201 source : AC1 3) chain A residue 45 type sequence V description BINDING SITE FOR RESIDUE A3T A 201 source : AC1 4) chain A residue 80 type sequence P description BINDING SITE FOR RESIDUE A3T A 201 source : AC1 5) chain A residue 81 type sequence F description BINDING SITE FOR RESIDUE A3T A 201 source : AC1 6) chain A residue 82 type sequence A description BINDING SITE FOR RESIDUE A3T A 201 source : AC1 7) chain A residue 89 type sequence A description BINDING SITE FOR RESIDUE A3T A 201 source : AC1 8) chain A residue 94 type sequence A description BINDING SITE FOR RESIDUE A3T A 201 source : AC1 9) chain A residue 117 type sequence F description BINDING SITE FOR RESIDUE A3T A 201 source : AC1 10) chain A residue 118 type sequence G description BINDING SITE FOR RESIDUE A3T A 201 source : AC1 11) chain A residue 119 type sequence Y description BINDING SITE FOR RESIDUE A3T A 201 source : AC1 12) chain A residue 120 type sequence Y description BINDING SITE FOR RESIDUE A3T A 201 source : AC1 13) chain A residue 121 type sequence M description BINDING SITE FOR RESIDUE A3T A 201 source : AC1 14) chain A residue 134 type sequence E description BINDING SITE FOR RESIDUE A3T B 201 source : AC2

Display surface Download Links