eF-site ID 4rrm-A
PDB Code 4rrm
Chain A

click to enlarge
Title E129A mutant of N-terminal editing domain of threonyl-tRNA synthetase from Aeropyrum pernix with L-Thr3AA
Classification LIGASE
Compound Probable threonine--tRNA ligase 2
Source Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) (SYT2_AERPE)
Sequence A:  MRLLYLHADRFEYKTVKPALKNPPDPPGEASFGEALVVFT
TVEDGDGPQTVMYAASDIASHSSRLKVTTVILYPYAHLSS
RLAKPMAAHKRLIELEGALRTKFPGHVHRAPFGWYKSFSI
ACKGHPLAALSRSFTE
Description (1)  Probable threonine--tRNA ligase 2 (E.C.6.1.1.3)


Functional site

1) chain A
residue 19
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A3T A 501
source : AC1

2) chain A
residue 40
type
ligand
sequence T
description BINDING SITE FOR RESIDUE A3T A 501
source : AC1

3) chain A
residue 42
type
ligand
sequence V
description BINDING SITE FOR RESIDUE A3T A 501
source : AC1

4) chain A
residue 75
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE A3T A 501
source : AC1

5) chain A
residue 76
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A3T A 501
source : AC1

6) chain A
residue 82
type
ligand
sequence L
description BINDING SITE FOR RESIDUE A3T A 501
source : AC1

7) chain A
residue 83
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A3T A 501
source : AC1

8) chain A
residue 88
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A3T A 501
source : AC1

9) chain A
residue 112
type
ligand
sequence F
description BINDING SITE FOR RESIDUE A3T A 501
source : AC1

10) chain A
residue 113
type
ligand
sequence G
description BINDING SITE FOR RESIDUE A3T A 501
source : AC1

11) chain A
residue 114
type
ligand
sequence W
description BINDING SITE FOR RESIDUE A3T A 501
source : AC1

12) chain A
residue 115
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE A3T A 501
source : AC1

13) chain A
residue 116
type
ligand
sequence K
description BINDING SITE FOR RESIDUE A3T A 501
source : AC1

14) chain A
residue 29
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG A 502
source : AC2

15) chain A
residue 100
type
ligand
sequence R
description BINDING SITE FOR RESIDUE CL A 503
source : AC3

16) chain A
residue 106
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CL A 503
source : AC3

17) chain A
residue 107
type
ligand
sequence V
description BINDING SITE FOR RESIDUE CL A 503
source : AC3

18) chain A
residue 133
type
ligand
sequence S
description BINDING SITE FOR RESIDUE CL A 503
source : AC3

19) chain A
residue 134
type
ligand
sequence F
description BINDING SITE FOR RESIDUE CL A 503
source : AC3

20) chain A
residue 19-20
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence AL
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrm_A_501

21) chain A
residue 40-42
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence TTV
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrm_A_501

22) chain A
residue 73-77
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence YPYAH
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrm_A_501

23) chain A
residue 82-83
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence LA
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrm_A_501

24) chain A
residue 85
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence P
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrm_A_501

25) chain A
residue 88
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence A
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrm_A_501

26) chain A
residue 92
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence L
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrm_A_501

27) chain A
residue 111-116
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence PFGWYK
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrm_A_501


Display surface

Download
Links