eF-site ID 4rrg-ABCD
PDB Code 4rrg
Chain A, B, C, D

click to enlarge
Title Editing domain of threonyl-tRNA synthetase from Methanococcus jannaschii with L-Thr3AA
Classification LIGASE
Compound Threonine--tRNA ligase
Source Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (SYT_METJA)
Sequence A:  MKMLLIHSDYLEFEAKEKTKIAEETENLKGKLDECLACFI
AVEREDENNPEGTAIGAVEEIEKVANQLKVNNIVVYPYAH
LSSDLSSPETAVKVLKDIESILKERGYNVLRAPFGWYKAF
KISCKGHPLSELSRKIVA
B:  MKMLLIHSDYLEFEAKEKTKIAEETENLKGKLDECLACFI
AVEREDENNPEGTAIGAVEEIEKVANQLKVNNIVVYPYAH
LSSDLSSPETAVKVLKDIESILKERGYNVLRAPFGWYKAF
KISCKGHPLSELSRKIVA
C:  MKMLLIHSDYLEFEAKEKTKIAEETENLKGKLDECLACFI
AVEREDENNPEGTAIGAVEEIEKVANQLKVNNIVVYPYAH
LSSDLSSPETAVKVLKDIESILKERGYNVLRAPFGWYKAF
KISCKGHPLSELSRKIV
D:  MKMLLIHSDYLEFEAKEKTKIAEETENLKGKLDECLACFI
AVEREDENNPEGTAIGAVEEIEKVANQLKVNNIVVYPYAH
LSSDLSSPETAVKVLKDIESILKERGYNVLRAPFGWYKAF
KISCKGHPLSELSRKIVA
Description (1)  Threonine--tRNA ligase (E.C.6.1.1.3)


Functional site

1) chain A
residue 25
type
ligand
sequence I
description BINDING SITE FOR RESIDUE A3T A 501
source : AC1

2) chain A
residue 44
type
ligand
sequence I
description BINDING SITE FOR RESIDUE A3T A 501
source : AC1

3) chain A
residue 46
type
ligand
sequence V
description BINDING SITE FOR RESIDUE A3T A 501
source : AC1

4) chain A
residue 81
type
ligand
sequence P
description BINDING SITE FOR RESIDUE A3T A 501
source : AC1

5) chain A
residue 82
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE A3T A 501
source : AC1

6) chain A
residue 83
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A3T A 501
source : AC1

7) chain A
residue 84
type
ligand
sequence H
description BINDING SITE FOR RESIDUE A3T A 501
source : AC1

8) chain A
residue 90
type
ligand
sequence S
description BINDING SITE FOR RESIDUE A3T A 501
source : AC1

9) chain A
residue 95
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A3T A 501
source : AC1

10) chain A
residue 118
type
ligand
sequence F
description BINDING SITE FOR RESIDUE A3T A 501
source : AC1

11) chain A
residue 119
type
ligand
sequence G
description BINDING SITE FOR RESIDUE A3T A 501
source : AC1

12) chain B
residue 135
type
ligand
sequence E
description BINDING SITE FOR RESIDUE A3T A 501
source : AC1

13) chain A
residue 135
type
ligand
sequence E
description BINDING SITE FOR RESIDUE A3T B 201
source : AC2

14) chain B
residue 25
type
ligand
sequence I
description BINDING SITE FOR RESIDUE A3T B 201
source : AC2

15) chain B
residue 44
type
ligand
sequence I
description BINDING SITE FOR RESIDUE A3T B 201
source : AC2

16) chain B
residue 46
type
ligand
sequence V
description BINDING SITE FOR RESIDUE A3T B 201
source : AC2

17) chain B
residue 82
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE A3T B 201
source : AC2

18) chain B
residue 83
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A3T B 201
source : AC2

19) chain B
residue 84
type
ligand
sequence H
description BINDING SITE FOR RESIDUE A3T B 201
source : AC2

20) chain B
residue 89
type
ligand
sequence L
description BINDING SITE FOR RESIDUE A3T B 201
source : AC2

21) chain B
residue 90
type
ligand
sequence S
description BINDING SITE FOR RESIDUE A3T B 201
source : AC2

22) chain B
residue 95
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A3T B 201
source : AC2

23) chain B
residue 118
type
ligand
sequence F
description BINDING SITE FOR RESIDUE A3T B 201
source : AC2

24) chain B
residue 119
type
ligand
sequence G
description BINDING SITE FOR RESIDUE A3T B 201
source : AC2

25) chain B
residue 121
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE A3T B 201
source : AC2

26) chain C
residue 25
type
ligand
sequence I
description BINDING SITE FOR RESIDUE A3T C 201
source : AC3

27) chain C
residue 44
type
ligand
sequence I
description BINDING SITE FOR RESIDUE A3T C 201
source : AC3

28) chain C
residue 46
type
ligand
sequence V
description BINDING SITE FOR RESIDUE A3T C 201
source : AC3

29) chain C
residue 82
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE A3T C 201
source : AC3

30) chain C
residue 83
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A3T C 201
source : AC3

31) chain C
residue 84
type
ligand
sequence H
description BINDING SITE FOR RESIDUE A3T C 201
source : AC3

32) chain C
residue 89
type
ligand
sequence L
description BINDING SITE FOR RESIDUE A3T C 201
source : AC3

33) chain C
residue 90
type
ligand
sequence S
description BINDING SITE FOR RESIDUE A3T C 201
source : AC3

34) chain C
residue 95
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A3T C 201
source : AC3

35) chain C
residue 118
type
ligand
sequence F
description BINDING SITE FOR RESIDUE A3T C 201
source : AC3

36) chain C
residue 119
type
ligand
sequence G
description BINDING SITE FOR RESIDUE A3T C 201
source : AC3

37) chain D
residue 135
type
ligand
sequence E
description BINDING SITE FOR RESIDUE A3T C 201
source : AC3

38) chain A
residue 23
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence T
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrg_A_501

39) chain A
residue 25
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence I
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrg_A_501

40) chain A
residue 44-46
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence IAV
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrg_A_501

41) chain A
residue 80-84
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence YPYAH
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrg_A_501

42) chain A
residue 89-92
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence LSSP
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrg_A_501

43) chain A
residue 95
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence A
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrg_A_501

44) chain A
residue 99
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence L
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrg_A_501

45) chain A
residue 117-122
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence PFGWYK
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrg_A_501

46) chain B
residue 135
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence E
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrg_A_501

47) chain A
residue 135
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence E
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrg_B_201

48) chain B
residue 25
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence I
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrg_B_201

49) chain B
residue 44-46
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence IAV
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrg_B_201

50) chain B
residue 80-84
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence YPYAH
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrg_B_201

51) chain B
residue 89-92
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence LSSP
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrg_B_201

52) chain B
residue 95
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence A
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrg_B_201

53) chain B
residue 99
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence L
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrg_B_201

54) chain B
residue 117-122
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence PFGWYK
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrg_B_201

55) chain C
residue 23
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence T
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrg_C_201

56) chain C
residue 25
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence I
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrg_C_201

57) chain C
residue 44-46
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence IAV
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrg_C_201

58) chain C
residue 80-84
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence YPYAH
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrg_C_201

59) chain C
residue 89-92
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence LSSP
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrg_C_201

60) chain C
residue 95
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence A
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrg_C_201

61) chain C
residue 99
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence L
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrg_C_201

62) chain C
residue 117-122
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence PFGWYK
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrg_C_201

63) chain D
residue 135
type binding
ligand A3T: 3'-deoxy-3'-(L-threonylamino)adenosine
sequence E
description 3'-deoxy-3'-(L-threonylamino)adenosine binding site
source pdb_hetatom : A3T_4rrg_C_201


Display surface

Download
Links