eF-site ID 4rrf-E
PDB Code 4rrf
Chain E

click to enlarge
Title Editing domain of threonyl-tRNA synthetase from Methanococcus jannaschii with L-Ser3AA
Classification LIGASE
Compound Threonine--tRNA ligase
Source Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (SYT_METJA)
Sequence E:  MKMLLIHSDYLEFEAKEKTKIAEETENLKGKLDECLACFI
AVEREDENNPEGTAIGAVEEIEKVANQLKVNNIVVYPYAH
LSSDLSSPETAVKVLKDIESILKERGYNVLRAPFGWYKAF
KISCKGHPLSELSRKIVAKE
Description (1)  Threonine--tRNA ligase (E.C.6.1.1.3)


Functional site

1) chain E
residue 25
type
ligand
sequence I
description BINDING SITE FOR RESIDUE A3S E 201
source : AC8

2) chain E
residue 44
type
ligand
sequence I
description BINDING SITE FOR RESIDUE A3S E 201
source : AC8

3) chain E
residue 46
type
ligand
sequence V
description BINDING SITE FOR RESIDUE A3S E 201
source : AC8

4) chain E
residue 81
type
ligand
sequence P
description BINDING SITE FOR RESIDUE A3S E 201
source : AC8

5) chain E
residue 82
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE A3S E 201
source : AC8

6) chain E
residue 83
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A3S E 201
source : AC8

7) chain E
residue 84
type
ligand
sequence H
description BINDING SITE FOR RESIDUE A3S E 201
source : AC8

8) chain E
residue 89
type
ligand
sequence L
description BINDING SITE FOR RESIDUE A3S E 201
source : AC8

9) chain E
residue 90
type
ligand
sequence S
description BINDING SITE FOR RESIDUE A3S E 201
source : AC8

10) chain E
residue 95
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A3S E 201
source : AC8

11) chain E
residue 118
type
ligand
sequence F
description BINDING SITE FOR RESIDUE A3S E 201
source : AC8

12) chain E
residue 119
type
ligand
sequence G
description BINDING SITE FOR RESIDUE A3S E 201
source : AC8

13) chain E
residue 121
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE A3S E 201
source : AC8

14) chain E
residue 135
type
ligand
sequence E
description BINDING SITE FOR RESIDUE A3S F 201
source : AC9

15) chain E
residue 23
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence T
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_E_201

16) chain E
residue 25
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence I
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_E_201

17) chain E
residue 44-46
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence IAV
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_E_201

18) chain E
residue 80-84
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence YPYAH
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_E_201

19) chain E
residue 89-92
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence LSSP
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_E_201

20) chain E
residue 95
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence A
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_E_201

21) chain E
residue 99
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence L
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_E_201

22) chain E
residue 117-122
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence PFGWYK
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_E_201

23) chain E
residue 135
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence E
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_F_201


Display surface

Download
Links