eF-site ID 4rrf-D
PDB Code 4rrf
Chain D

click to enlarge
Title Editing domain of threonyl-tRNA synthetase from Methanococcus jannaschii with L-Ser3AA
Classification LIGASE
Compound Threonine--tRNA ligase
Source Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (SYT_METJA)
Sequence D:  MKMLLIHSDYLEFEAKEKTKIAEETENLKGKLDECLACFI
AVEREDENNPEGTAIGAVEEIEKVANQLKVNNIVVYPYAH
LSSDLSSPETAVKVLKDIESILKERGYNVLRAPFGWYKAF
KISCKGHPLSELSRKIVAK
Description (1)  Threonine--tRNA ligase (E.C.6.1.1.3)


Functional site

1) chain D
residue 135
type
ligand
sequence E
description BINDING SITE FOR RESIDUE A3S A 501
source : AC1

2) chain D
residue 25
type
ligand
sequence I
description BINDING SITE FOR RESIDUE A3S D 201
source : AC6

3) chain D
residue 44
type
ligand
sequence I
description BINDING SITE FOR RESIDUE A3S D 201
source : AC6

4) chain D
residue 46
type
ligand
sequence V
description BINDING SITE FOR RESIDUE A3S D 201
source : AC6

5) chain D
residue 82
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE A3S D 201
source : AC6

6) chain D
residue 83
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A3S D 201
source : AC6

7) chain D
residue 84
type
ligand
sequence H
description BINDING SITE FOR RESIDUE A3S D 201
source : AC6

8) chain D
residue 89
type
ligand
sequence L
description BINDING SITE FOR RESIDUE A3S D 201
source : AC6

9) chain D
residue 90
type
ligand
sequence S
description BINDING SITE FOR RESIDUE A3S D 201
source : AC6

10) chain D
residue 95
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A3S D 201
source : AC6

11) chain D
residue 118
type
ligand
sequence F
description BINDING SITE FOR RESIDUE A3S D 201
source : AC6

12) chain D
residue 119
type
ligand
sequence G
description BINDING SITE FOR RESIDUE A3S D 201
source : AC6

13) chain D
residue 135
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence E
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_A_501

14) chain D
residue 23
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence T
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_D_201

15) chain D
residue 25
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence I
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_D_201

16) chain D
residue 44-46
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence IAV
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_D_201

17) chain D
residue 80-84
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence YPYAH
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_D_201

18) chain D
residue 89-92
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence LSSP
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_D_201

19) chain D
residue 95
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence A
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_D_201

20) chain D
residue 99
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence L
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_D_201

21) chain D
residue 117-122
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence PFGWYK
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_D_201


Display surface

Download
Links