eF-site ID 4rrf-C
PDB Code 4rrf
Chain C

click to enlarge
Title Editing domain of threonyl-tRNA synthetase from Methanococcus jannaschii with L-Ser3AA
Classification LIGASE
Compound Threonine--tRNA ligase
Source Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (SYT_METJA)
Sequence C:  MKMLLIHSDYLEFEAKEKTKIAEETENLKGKLDECLACFI
AVEREDENNPEGTAIGAVEEIEKVANQLKVNNIVVYPYAH
LSSDLSSPETAVKVLKDIESILKERGYNVLRAPFGWYKAF
KISCKGHPLSELSRKIVAK
Description (1)  Threonine--tRNA ligase (E.C.6.1.1.3)


Functional site

1) chain C
residue 135
type
ligand
sequence E
description BINDING SITE FOR RESIDUE A3S B 201
source : AC3

2) chain C
residue 25
type
ligand
sequence I
description BINDING SITE FOR RESIDUE A3S C 201
source : AC4

3) chain C
residue 44
type
ligand
sequence I
description BINDING SITE FOR RESIDUE A3S C 201
source : AC4

4) chain C
residue 46
type
ligand
sequence V
description BINDING SITE FOR RESIDUE A3S C 201
source : AC4

5) chain C
residue 82
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE A3S C 201
source : AC4

6) chain C
residue 83
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A3S C 201
source : AC4

7) chain C
residue 89
type
ligand
sequence L
description BINDING SITE FOR RESIDUE A3S C 201
source : AC4

8) chain C
residue 90
type
ligand
sequence S
description BINDING SITE FOR RESIDUE A3S C 201
source : AC4

9) chain C
residue 95
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A3S C 201
source : AC4

10) chain C
residue 118
type
ligand
sequence F
description BINDING SITE FOR RESIDUE A3S C 201
source : AC4

11) chain C
residue 119
type
ligand
sequence G
description BINDING SITE FOR RESIDUE A3S C 201
source : AC4

12) chain C
residue 135
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence E
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_B_201

13) chain C
residue 25
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence I
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_C_201

14) chain C
residue 44-46
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence IAV
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_C_201

15) chain C
residue 80-84
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence YPYAH
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_C_201

16) chain C
residue 89-92
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence LSSP
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_C_201

17) chain C
residue 95
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence A
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_C_201

18) chain C
residue 99
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence L
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_C_201

19) chain C
residue 117-122
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence PFGWYK
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_C_201


Display surface

Download
Links