eF-site ID 4rrf-B
PDB Code 4rrf
Chain B

click to enlarge
Title Editing domain of threonyl-tRNA synthetase from Methanococcus jannaschii with L-Ser3AA
Classification LIGASE
Compound Threonine--tRNA ligase
Source Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (SYT_METJA)
Sequence B:  MKMLLIHSDYLEFEAKEKTKIAEETENLKGKLDECLACFI
AVEREDENNPEGTAIGAVEEIEKVANQLKVNNIVVYPYAH
LSSDLSSPETAVKVLKDIESILKERGYNVLRAPFGWYKAF
KISCKGHPLSELSRKIV
Description (1)  Threonine--tRNA ligase (E.C.6.1.1.3)


Functional site

1) chain B
residue 44
type
ligand
sequence I
description BINDING SITE FOR RESIDUE A3S B 201
source : AC3

2) chain B
residue 46
type
ligand
sequence V
description BINDING SITE FOR RESIDUE A3S B 201
source : AC3

3) chain B
residue 81
type
ligand
sequence P
description BINDING SITE FOR RESIDUE A3S B 201
source : AC3

4) chain B
residue 82
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE A3S B 201
source : AC3

5) chain B
residue 83
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A3S B 201
source : AC3

6) chain B
residue 89
type
ligand
sequence L
description BINDING SITE FOR RESIDUE A3S B 201
source : AC3

7) chain B
residue 90
type
ligand
sequence S
description BINDING SITE FOR RESIDUE A3S B 201
source : AC3

8) chain B
residue 95
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A3S B 201
source : AC3

9) chain B
residue 118
type
ligand
sequence F
description BINDING SITE FOR RESIDUE A3S B 201
source : AC3

10) chain B
residue 119
type
ligand
sequence G
description BINDING SITE FOR RESIDUE A3S B 201
source : AC3

11) chain B
residue 121
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE A3S B 201
source : AC3

12) chain B
residue 135
type
ligand
sequence E
description BINDING SITE FOR RESIDUE A3S C 201
source : AC4

13) chain B
residue 23
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence T
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_B_201

14) chain B
residue 25
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence I
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_B_201

15) chain B
residue 44-47
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence IAVE
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_B_201

16) chain B
residue 81-84
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence PYAH
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_B_201

17) chain B
residue 89-92
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence LSSP
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_B_201

18) chain B
residue 95
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence A
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_B_201

19) chain B
residue 99
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence L
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_B_201

20) chain B
residue 117-122
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence PFGWYK
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_B_201

21) chain B
residue 135
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence E
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_C_201


Display surface

Download
Links