eF-site ID 4rrf-ABCDEF
PDB Code 4rrf
Chain A, B, C, D, E, F

click to enlarge
Title Editing domain of threonyl-tRNA synthetase from Methanococcus jannaschii with L-Ser3AA
Classification LIGASE
Compound Threonine--tRNA ligase
Source Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (SYT_METJA)
Sequence A:  MKMLLIHSDYLEFEAKEKTKIAEETENLKGKLDECLACFI
AVEREDENNPEGTAIGAVEEIEKVANQLKVNNIVVYPYAH
LSSDLSSPETAVKVLKDIESILKERGYNVLRAPFGWYKAF
KISCKGHPLSELSRKIVA
B:  MKMLLIHSDYLEFEAKEKTKIAEETENLKGKLDECLACFI
AVEREDENNPEGTAIGAVEEIEKVANQLKVNNIVVYPYAH
LSSDLSSPETAVKVLKDIESILKERGYNVLRAPFGWYKAF
KISCKGHPLSELSRKIV
C:  MKMLLIHSDYLEFEAKEKTKIAEETENLKGKLDECLACFI
AVEREDENNPEGTAIGAVEEIEKVANQLKVNNIVVYPYAH
LSSDLSSPETAVKVLKDIESILKERGYNVLRAPFGWYKAF
KISCKGHPLSELSRKIVAK
D:  MKMLLIHSDYLEFEAKEKTKIAEETENLKGKLDECLACFI
AVEREDENNPEGTAIGAVEEIEKVANQLKVNNIVVYPYAH
LSSDLSSPETAVKVLKDIESILKERGYNVLRAPFGWYKAF
KISCKGHPLSELSRKIVAK
E:  MKMLLIHSDYLEFEAKEKTKIAEETENLKGKLDECLACFI
AVEREDENNPEGTAIGAVEEIEKVANQLKVNNIVVYPYAH
LSSDLSSPETAVKVLKDIESILKERGYNVLRAPFGWYKAF
KISCKGHPLSELSRKIVAKE
F:  MKMLLIHSDYLEFEAKEKTKIAEETENLKGKLDECLACFI
AVEREDENNPEGTAIGAVEEIEKVANQLKVNNIVVYPYAH
LSSDLSSPETAVKVLKDIESILKERGYNVLRAPFGWYKAF
KISCKGHPLSELSRKIVAKE
Description (1)  Threonine--tRNA ligase (E.C.6.1.1.3)


Functional site

1) chain A
residue 25
type
ligand
sequence I
description BINDING SITE FOR RESIDUE A3S A 501
source : AC1

2) chain A
residue 44
type
ligand
sequence I
description BINDING SITE FOR RESIDUE A3S A 501
source : AC1

3) chain A
residue 46
type
ligand
sequence V
description BINDING SITE FOR RESIDUE A3S A 501
source : AC1

4) chain A
residue 81
type
ligand
sequence P
description BINDING SITE FOR RESIDUE A3S A 501
source : AC1

5) chain A
residue 82
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE A3S A 501
source : AC1

6) chain A
residue 83
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A3S A 501
source : AC1

7) chain A
residue 84
type
ligand
sequence H
description BINDING SITE FOR RESIDUE A3S A 501
source : AC1

8) chain A
residue 89
type
ligand
sequence L
description BINDING SITE FOR RESIDUE A3S A 501
source : AC1

9) chain A
residue 90
type
ligand
sequence S
description BINDING SITE FOR RESIDUE A3S A 501
source : AC1

10) chain A
residue 95
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A3S A 501
source : AC1

11) chain A
residue 118
type
ligand
sequence F
description BINDING SITE FOR RESIDUE A3S A 501
source : AC1

12) chain A
residue 119
type
ligand
sequence G
description BINDING SITE FOR RESIDUE A3S A 501
source : AC1

13) chain A
residue 120
type
ligand
sequence W
description BINDING SITE FOR RESIDUE A3S A 501
source : AC1

14) chain A
residue 121
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE A3S A 501
source : AC1

15) chain A
residue 122
type
ligand
sequence K
description BINDING SITE FOR RESIDUE A3S A 501
source : AC1

16) chain D
residue 135
type
ligand
sequence E
description BINDING SITE FOR RESIDUE A3S A 501
source : AC1

17) chain A
residue 27
type
ligand
sequence E
description BINDING SITE FOR RESIDUE CL A 502
source : AC2

18) chain A
residue 29
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CL A 502
source : AC2

19) chain A
residue 115
type
ligand
sequence R
description BINDING SITE FOR RESIDUE CL A 502
source : AC2

20) chain A
residue 118
type
ligand
sequence F
description BINDING SITE FOR RESIDUE CL A 502
source : AC2

21) chain B
residue 44
type
ligand
sequence I
description BINDING SITE FOR RESIDUE A3S B 201
source : AC3

22) chain B
residue 46
type
ligand
sequence V
description BINDING SITE FOR RESIDUE A3S B 201
source : AC3

23) chain B
residue 81
type
ligand
sequence P
description BINDING SITE FOR RESIDUE A3S B 201
source : AC3

24) chain B
residue 82
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE A3S B 201
source : AC3

25) chain B
residue 83
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A3S B 201
source : AC3

26) chain B
residue 89
type
ligand
sequence L
description BINDING SITE FOR RESIDUE A3S B 201
source : AC3

27) chain B
residue 90
type
ligand
sequence S
description BINDING SITE FOR RESIDUE A3S B 201
source : AC3

28) chain B
residue 95
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A3S B 201
source : AC3

29) chain B
residue 118
type
ligand
sequence F
description BINDING SITE FOR RESIDUE A3S B 201
source : AC3

30) chain B
residue 119
type
ligand
sequence G
description BINDING SITE FOR RESIDUE A3S B 201
source : AC3

31) chain B
residue 121
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE A3S B 201
source : AC3

32) chain C
residue 135
type
ligand
sequence E
description BINDING SITE FOR RESIDUE A3S B 201
source : AC3

33) chain B
residue 135
type
ligand
sequence E
description BINDING SITE FOR RESIDUE A3S C 201
source : AC4

34) chain C
residue 25
type
ligand
sequence I
description BINDING SITE FOR RESIDUE A3S C 201
source : AC4

35) chain C
residue 44
type
ligand
sequence I
description BINDING SITE FOR RESIDUE A3S C 201
source : AC4

36) chain C
residue 46
type
ligand
sequence V
description BINDING SITE FOR RESIDUE A3S C 201
source : AC4

37) chain C
residue 82
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE A3S C 201
source : AC4

38) chain C
residue 83
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A3S C 201
source : AC4

39) chain C
residue 89
type
ligand
sequence L
description BINDING SITE FOR RESIDUE A3S C 201
source : AC4

40) chain C
residue 90
type
ligand
sequence S
description BINDING SITE FOR RESIDUE A3S C 201
source : AC4

41) chain C
residue 95
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A3S C 201
source : AC4

42) chain C
residue 118
type
ligand
sequence F
description BINDING SITE FOR RESIDUE A3S C 201
source : AC4

43) chain C
residue 119
type
ligand
sequence G
description BINDING SITE FOR RESIDUE A3S C 201
source : AC4

44) chain A
residue 135
type
ligand
sequence E
description BINDING SITE FOR RESIDUE A3S D 201
source : AC6

45) chain D
residue 25
type
ligand
sequence I
description BINDING SITE FOR RESIDUE A3S D 201
source : AC6

46) chain D
residue 44
type
ligand
sequence I
description BINDING SITE FOR RESIDUE A3S D 201
source : AC6

47) chain D
residue 46
type
ligand
sequence V
description BINDING SITE FOR RESIDUE A3S D 201
source : AC6

48) chain D
residue 82
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE A3S D 201
source : AC6

49) chain D
residue 83
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A3S D 201
source : AC6

50) chain D
residue 84
type
ligand
sequence H
description BINDING SITE FOR RESIDUE A3S D 201
source : AC6

51) chain D
residue 89
type
ligand
sequence L
description BINDING SITE FOR RESIDUE A3S D 201
source : AC6

52) chain D
residue 90
type
ligand
sequence S
description BINDING SITE FOR RESIDUE A3S D 201
source : AC6

53) chain D
residue 95
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A3S D 201
source : AC6

54) chain D
residue 118
type
ligand
sequence F
description BINDING SITE FOR RESIDUE A3S D 201
source : AC6

55) chain D
residue 119
type
ligand
sequence G
description BINDING SITE FOR RESIDUE A3S D 201
source : AC6

56) chain E
residue 25
type
ligand
sequence I
description BINDING SITE FOR RESIDUE A3S E 201
source : AC8

57) chain E
residue 44
type
ligand
sequence I
description BINDING SITE FOR RESIDUE A3S E 201
source : AC8

58) chain E
residue 46
type
ligand
sequence V
description BINDING SITE FOR RESIDUE A3S E 201
source : AC8

59) chain E
residue 81
type
ligand
sequence P
description BINDING SITE FOR RESIDUE A3S E 201
source : AC8

60) chain E
residue 82
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE A3S E 201
source : AC8

61) chain E
residue 83
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A3S E 201
source : AC8

62) chain E
residue 84
type
ligand
sequence H
description BINDING SITE FOR RESIDUE A3S E 201
source : AC8

63) chain E
residue 89
type
ligand
sequence L
description BINDING SITE FOR RESIDUE A3S E 201
source : AC8

64) chain E
residue 90
type
ligand
sequence S
description BINDING SITE FOR RESIDUE A3S E 201
source : AC8

65) chain E
residue 95
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A3S E 201
source : AC8

66) chain E
residue 118
type
ligand
sequence F
description BINDING SITE FOR RESIDUE A3S E 201
source : AC8

67) chain E
residue 119
type
ligand
sequence G
description BINDING SITE FOR RESIDUE A3S E 201
source : AC8

68) chain E
residue 121
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE A3S E 201
source : AC8

69) chain F
residue 135
type
ligand
sequence E
description BINDING SITE FOR RESIDUE A3S E 201
source : AC8

70) chain E
residue 135
type
ligand
sequence E
description BINDING SITE FOR RESIDUE A3S F 201
source : AC9

71) chain F
residue 25
type
ligand
sequence I
description BINDING SITE FOR RESIDUE A3S F 201
source : AC9

72) chain F
residue 44
type
ligand
sequence I
description BINDING SITE FOR RESIDUE A3S F 201
source : AC9

73) chain F
residue 45
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A3S F 201
source : AC9

74) chain F
residue 46
type
ligand
sequence V
description BINDING SITE FOR RESIDUE A3S F 201
source : AC9

75) chain F
residue 82
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE A3S F 201
source : AC9

76) chain F
residue 83
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A3S F 201
source : AC9

77) chain F
residue 84
type
ligand
sequence H
description BINDING SITE FOR RESIDUE A3S F 201
source : AC9

78) chain F
residue 90
type
ligand
sequence S
description BINDING SITE FOR RESIDUE A3S F 201
source : AC9

79) chain F
residue 95
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A3S F 201
source : AC9

80) chain F
residue 118
type
ligand
sequence F
description BINDING SITE FOR RESIDUE A3S F 201
source : AC9

81) chain F
residue 119
type
ligand
sequence G
description BINDING SITE FOR RESIDUE A3S F 201
source : AC9

82) chain F
residue 121
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE A3S F 201
source : AC9

83) chain F
residue 122
type
ligand
sequence K
description BINDING SITE FOR RESIDUE A3S F 201
source : AC9

84) chain A
residue 23
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence T
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_A_501

85) chain A
residue 25
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence I
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_A_501

86) chain A
residue 44-47
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence IAVE
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_A_501

87) chain A
residue 80-84
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence YPYAH
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_A_501

88) chain A
residue 89-92
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence LSSP
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_A_501

89) chain A
residue 95
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence A
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_A_501

90) chain A
residue 99
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence L
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_A_501

91) chain A
residue 117-122
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence PFGWYK
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_A_501

92) chain D
residue 135
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence E
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_A_501

93) chain A
residue 135
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence E
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_D_201

94) chain D
residue 23
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence T
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_D_201

95) chain D
residue 25
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence I
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_D_201

96) chain D
residue 44-46
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence IAV
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_D_201

97) chain D
residue 80-84
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence YPYAH
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_D_201

98) chain D
residue 89-92
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence LSSP
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_D_201

99) chain D
residue 95
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence A
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_D_201

100) chain D
residue 99
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence L
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_D_201

101) chain D
residue 117-122
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence PFGWYK
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_D_201

102) chain B
residue 23
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence T
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_B_201

103) chain B
residue 25
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence I
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_B_201

104) chain B
residue 44-47
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence IAVE
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_B_201

105) chain B
residue 81-84
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence PYAH
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_B_201

106) chain B
residue 89-92
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence LSSP
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_B_201

107) chain B
residue 95
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence A
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_B_201

108) chain B
residue 99
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence L
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_B_201

109) chain B
residue 117-122
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence PFGWYK
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_B_201

110) chain C
residue 135
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence E
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_B_201

111) chain B
residue 135
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence E
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_C_201

112) chain C
residue 25
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence I
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_C_201

113) chain C
residue 44-46
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence IAV
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_C_201

114) chain C
residue 80-84
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence YPYAH
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_C_201

115) chain C
residue 89-92
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence LSSP
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_C_201

116) chain C
residue 95
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence A
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_C_201

117) chain C
residue 99
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence L
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_C_201

118) chain C
residue 117-122
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence PFGWYK
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_C_201

119) chain E
residue 23
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence T
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_E_201

120) chain E
residue 25
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence I
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_E_201

121) chain E
residue 44-46
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence IAV
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_E_201

122) chain E
residue 80-84
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence YPYAH
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_E_201

123) chain E
residue 89-92
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence LSSP
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_E_201

124) chain E
residue 95
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence A
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_E_201

125) chain E
residue 99
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence L
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_E_201

126) chain E
residue 117-122
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence PFGWYK
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_E_201

127) chain F
residue 135
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence E
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_E_201

128) chain E
residue 135
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence E
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_F_201

129) chain F
residue 23
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence T
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_F_201

130) chain F
residue 25
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence I
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_F_201

131) chain F
residue 44-46
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence IAV
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_F_201

132) chain F
residue 81-84
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence PYAH
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_F_201

133) chain F
residue 89-92
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence LSSP
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_F_201

134) chain F
residue 95
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence A
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_F_201

135) chain F
residue 99
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence L
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_F_201

136) chain F
residue 117-122
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence PFGWYK
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_F_201


Display surface

Download
Links