eF-site ID 4rrf-A
PDB Code 4rrf
Chain A

click to enlarge
Title Editing domain of threonyl-tRNA synthetase from Methanococcus jannaschii with L-Ser3AA
Classification LIGASE
Compound Threonine--tRNA ligase
Source Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (SYT_METJA)
Sequence A:  MKMLLIHSDYLEFEAKEKTKIAEETENLKGKLDECLACFI
AVEREDENNPEGTAIGAVEEIEKVANQLKVNNIVVYPYAH
LSSDLSSPETAVKVLKDIESILKERGYNVLRAPFGWYKAF
KISCKGHPLSELSRKIVA
Description (1)  Threonine--tRNA ligase (E.C.6.1.1.3)


Functional site

1) chain A
residue 25
type
ligand
sequence I
description BINDING SITE FOR RESIDUE A3S A 501
source : AC1

2) chain A
residue 44
type
ligand
sequence I
description BINDING SITE FOR RESIDUE A3S A 501
source : AC1

3) chain A
residue 46
type
ligand
sequence V
description BINDING SITE FOR RESIDUE A3S A 501
source : AC1

4) chain A
residue 81
type
ligand
sequence P
description BINDING SITE FOR RESIDUE A3S A 501
source : AC1

5) chain A
residue 82
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE A3S A 501
source : AC1

6) chain A
residue 83
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A3S A 501
source : AC1

7) chain A
residue 84
type
ligand
sequence H
description BINDING SITE FOR RESIDUE A3S A 501
source : AC1

8) chain A
residue 89
type
ligand
sequence L
description BINDING SITE FOR RESIDUE A3S A 501
source : AC1

9) chain A
residue 90
type
ligand
sequence S
description BINDING SITE FOR RESIDUE A3S A 501
source : AC1

10) chain A
residue 95
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A3S A 501
source : AC1

11) chain A
residue 118
type
ligand
sequence F
description BINDING SITE FOR RESIDUE A3S A 501
source : AC1

12) chain A
residue 119
type
ligand
sequence G
description BINDING SITE FOR RESIDUE A3S A 501
source : AC1

13) chain A
residue 120
type
ligand
sequence W
description BINDING SITE FOR RESIDUE A3S A 501
source : AC1

14) chain A
residue 121
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE A3S A 501
source : AC1

15) chain A
residue 122
type
ligand
sequence K
description BINDING SITE FOR RESIDUE A3S A 501
source : AC1

16) chain A
residue 27
type
ligand
sequence E
description BINDING SITE FOR RESIDUE CL A 502
source : AC2

17) chain A
residue 29
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CL A 502
source : AC2

18) chain A
residue 115
type
ligand
sequence R
description BINDING SITE FOR RESIDUE CL A 502
source : AC2

19) chain A
residue 118
type
ligand
sequence F
description BINDING SITE FOR RESIDUE CL A 502
source : AC2

20) chain A
residue 135
type
ligand
sequence E
description BINDING SITE FOR RESIDUE A3S D 201
source : AC6

21) chain A
residue 23
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence T
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_A_501

22) chain A
residue 25
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence I
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_A_501

23) chain A
residue 44-47
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence IAVE
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_A_501

24) chain A
residue 80-84
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence YPYAH
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_A_501

25) chain A
residue 89-92
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence LSSP
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_A_501

26) chain A
residue 95
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence A
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_A_501

27) chain A
residue 99
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence L
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_A_501

28) chain A
residue 117-122
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence PFGWYK
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_A_501

29) chain A
residue 135
type binding
ligand A3S: SERINE-3'-AMINOADENOSINE
sequence E
description SERINE-3'-AMINOADENOSINE binding site
source pdb_hetatom : A3S_4rrf_D_201


Display surface

Download
Links