eF-site ID 4rhw-D PDB Code 4rhw Chain D click to enlarge Title Crystal structure of Apaf-1 CARD and caspase-9 CARD complex Classification APOPTOSIS Compound Apoptotic protease-activating factor 1 Source (CASP9_HUMAN) Sequence D:  MDAKARNCLLQHREALEKDIKTSYIMDHMISDGFLTISEE EKVRNEPTQQQRAAMLIKMILKKDNDSYVSFYNALLHEGY KDLAALLHDGIP Description Functional site 1) chain D residue 48 type sequence T description BINDING SITE FOR RESIDUE SO4 B 102 source : AC4 2) chain D residue 49 type sequence Q description BINDING SITE FOR RESIDUE SO4 B 102 source : AC4 3) chain D residue 52 type sequence R description BINDING SITE FOR RESIDUE SO4 B 102 source : AC4 4) chain D residue 21 type sequence K description BINDING SITE FOR RESIDUE SO4 D 101 source : AC7 5) chain D residue 22 type sequence T description BINDING SITE FOR RESIDUE SO4 D 101 source : AC7 6) chain D residue 23 type sequence S description BINDING SITE FOR RESIDUE SO4 D 101 source : AC7 7) chain D residue 49 type sequence Q description BINDING SITE FOR RESIDUE SO4 D 101 source : AC7 8) chain D residue 52 type sequence R description BINDING SITE FOR RESIDUE SO4 D 101 source : AC7 9) chain D residue 38 type sequence S description BINDING SITE FOR RESIDUE CL D 102 source : AC8

Display surface Download Links